Mustela nigripes (black-footed ferret): 132009293 Help Entry 132009293         CDS       T09425                                  Name (RefSeq) histone H2B type 2-F-like   KO K11252   histone H2B Organism mnp  Mustela nigripes (black-footed ferret) Pathway mnp04613   Neutrophil extracellular trap formation mnp05034   Alcoholism mnp05203   Viral carcinogenesis mnp05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mnp00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     132009293  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     132009293   09163 Immune disease    05322 Systemic lupus erythematosus     132009293   09165 Substance dependence    05034 Alcoholism     132009293  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mnp03036]     132009293   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mnp04147]     132009293 Chromosome and associated proteins [BR:mnp03036]  Eukaryotic type   Nucleosome assembly factors    Histones     132009293 Exosome [BR:mnp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    132009293 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa Motif Other DBs NCBI-GeneID:  132009293 NCBI-ProteinID:  XP_059243550 LinkDB All DBs Position Unknown AA seq 95 aa AA seqDB search MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREI NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgcctgatccagcaaagtcggctcctgctcccaagaaaggctctaagaaagctgttacc aaagtgcagaagaaggacggcaagaagcgcaagcgcagccgtaaggagagctattccgtt tacgtgtataaagtgttgaagcaggtgcacccggacaccggcatctcgtccaaggccatg ggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgccggcgaggcctcccga ttggcgcattacaacaagcgctccaccatcacgtcgcgggagatc

DBGET integrated database retrieval system