Mustela nigripes (black-footed ferret): 132010451 Help Entry 132010451         CDS       T09425                                  Name (RefSeq) histone H3.3-like type 2   KO K11253   histone H3 Organism mnp  Mustela nigripes (black-footed ferret) Pathway mnp04613   Neutrophil extracellular trap formation mnp05034   Alcoholism mnp05202   Transcriptional misregulation in cancer mnp05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mnp00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     132010451  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     132010451   09163 Immune disease    05322 Systemic lupus erythematosus     132010451   09165 Substance dependence    05034 Alcoholism     132010451  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mnp03036]     132010451   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mnp04147]     132010451 Chromosome and associated proteins [BR:mnp03036]  Eukaryotic type   Nucleosome assembly factors    Histones     132010451 Exosome [BR:mnp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    132010451 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Motif Other DBs NCBI-GeneID:  132010451 NCBI-ProteinID:  XP_059244290 LinkDB All DBs Position 2:60661461..60677293 Genome browser AA seq 137 aa AA seqDB search MKEAESPRRAGTAEDENTKEDSALTVEDIMVTGQIRTKGIAFVPGKPPLDEELIDHKNGL KIGHYQKSAELLIGKLPFQHLVLEIAQDFKKTDQYFQSAALGALQEPREAHLVHLFAVTN LCAIQAKGVTIGQKTSS NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgaaggaggcagagtcaccccggagagctgggactgcagaggatgagaacaccaaggag gacagtgctctaactgttgaggatatcatggtaactggccagattaggacaaaaggaatc gcctttgttcctgggaaaccacctttggatgaagagctgatagaccataaaaatggcctg aaaattggacattatcagaagtccgctgaacttctgattggcaaacttcctttccagcat ctggtgctagaaattgctcaggacttcaagaaaacagatcagtacttccagagtgcagct cttggagctttgcaggagccaagggaggcacatctggtgcacctttttgcagtcaccaac ctatgcgctatccaggccaaaggtgtaacaatagggcaaaagacatccagctag

DBGET integrated database retrieval system