Mustela nigripes (black-footed ferret): 132011120 Help Entry 132011120         CDS       T09425                                  Symbol RAB8A Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism mnp  Mustela nigripes (black-footed ferret) Pathway mnp04140   Autophagy - animal mnp04144   Endocytosis mnp04152   AMPK signaling pathway mnp04530   Tight junction mnp04972   Pancreatic secretion mnp05014   Amyotrophic lateral sclerosis mnp05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:mnp00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     132011120 (RAB8A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     132011120 (RAB8A)    04140 Autophagy - animal     132011120 (RAB8A)   09144 Cellular community - eukaryotes    04530 Tight junction     132011120 (RAB8A)  09150 Organismal Systems   09154 Digestive system    04972 Pancreatic secretion     132011120 (RAB8A)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     132011120 (RAB8A)    05022 Pathways of neurodegeneration - multiple diseases     132011120 (RAB8A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mnp04131]     132011120 (RAB8A)    03036 Chromosome and associated proteins [BR:mnp03036]     132011120 (RAB8A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mnp04147]     132011120 (RAB8A)    04031 GTP-binding proteins [BR:mnp04031]     132011120 (RAB8A) Membrane trafficking [BR:mnp04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     132011120 (RAB8A)  Autophagy   Other autophagy associated proteins     132011120 (RAB8A) Chromosome and associated proteins [BR:mnp03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     132011120 (RAB8A) Exosome [BR:mnp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    132011120 (RAB8A)   Exosomal proteins of other body fluids (saliva and urine)    132011120 (RAB8A)   Exosomal proteins of colorectal cancer cells    132011120 (RAB8A) GTP-binding proteins [BR:mnp04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     132011120 (RAB8A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA GTP_EFTU SRPRB MMR_HSR1 DUF3963 Septin AAA_7 Motif Other DBs NCBI-GeneID:  132011120 NCBI-ProteinID:  XP_059245275 LinkDB All DBs Position 2:12473184..12491841 Genome browser AA seq 207 aa AA seqDB search MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG NKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGN SPQGSNQGVKITPDQQKRSSFFRCVLL NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcgaagacctacgattacctgttcaagctgctgctgattggggactcgggggttggg aagacctgtgtcctgttccgcttctccgaggacgccttcaactcaactttcatctccacc ataggaattgactttaaaattaggaccatagaactcgatggcaagagaattaagctacag atatgggacacagctggtcaggaacggtttcggacgatcacaacagcctactacaggggc gcaatgggcatcatgctggtctatgacatcaccaacgagaagtcctttgacaacatccgg aactggattcggaacattgaggagcatgcttctgcagatgtcgaaaagatgatactcggg aacaagtgtgatgtgaacgacaagagacaagtttccaaggaacggggagaaaagctggcc ctggactacggaatcaagttcatggagaccagtgcgaaggccaacatcaatgtggagaat gcgtttttcactctcgccagagacatcaaagcaaaaatggacaaaaaattggaaggcaac agtccccaagggagcaaccagggagtcaaaatcacaccagaccagcagaagaggagcagc tttttccgatgtgttcttctgtga

DBGET integrated database retrieval system