Mustela nigripes (black-footed ferret): 132011523 Help Entry 132011523         CDS       T09425                                  Name (RefSeq) protein S100-A10-like   KO K17274   protein S100-A10 Organism mnp  Mustela nigripes (black-footed ferret) Pathway mnp04382   Cornified envelope formation mnp05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mnp00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     132011523  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     132011523  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mnp04147]     132011523 Exosome [BR:mnp04147]  Exosomal proteins   Exosomal proteins of microglial cells    132011523 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EFhand_Ca_insen EF-hand_7 TFIIE_beta STAT_linker Motif Other DBs NCBI-GeneID:  132011523 NCBI-ProteinID:  XP_059246191 LinkDB All DBs Position 2:49209869..49210331 Genome browser AA seq 97 aa AA seqDB search MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLQVLMEKEFAGFLKNQKDPLTMDKIMKDLD QCRDVKVGFQSCFSLIAGLNIACNDYFVVHMKQKRKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccatctcaaatggaacatgccatggaaaccatgatgttcacatttcacaagtttgct ggggataaagggtacttaacaaaggaggatctgcaagtactcatggaaaaggagtttgca ggatttttgaaaaatcagaaagaccctctgaccatggacaaaataatgaaggacctcgac cagtgccgagatgtcaaagtgggcttccagagctgcttctcactaatcgcggggctcaac attgcatgcaatgactattttgtagtacacatgaagcagaagagaaagaagtag

DBGET integrated database retrieval system