Mustela nigripes (black-footed ferret): 132011760 Help Entry 132011760         CDS       T09425                                  Symbol RAB5A Name (RefSeq) ras-related protein Rab-5A   KO K07887   Ras-related protein Rab-5A Organism mnp  Mustela nigripes (black-footed ferret) Pathway mnp04014   Ras signaling pathway mnp04137   Mitophagy - animal mnp04144   Endocytosis mnp04145   Phagosome mnp04148   Efferocytosis mnp04962   Vasopressin-regulated water reabsorption mnp05014   Amyotrophic lateral sclerosis mnp05022   Pathways of neurodegeneration - multiple diseases mnp05132   Salmonella infection mnp05146   Amoebiasis mnp05152   Tuberculosis Brite KEGG Orthology (KO) [BR:mnp00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     132011760 (RAB5A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     132011760 (RAB5A)    04145 Phagosome     132011760 (RAB5A)    04137 Mitophagy - animal     132011760 (RAB5A)    04148 Efferocytosis     132011760 (RAB5A)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     132011760 (RAB5A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     132011760 (RAB5A)    05152 Tuberculosis     132011760 (RAB5A)   09174 Infectious disease: parasitic    05146 Amoebiasis     132011760 (RAB5A)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     132011760 (RAB5A)    05022 Pathways of neurodegeneration - multiple diseases     132011760 (RAB5A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mnp04131]     132011760 (RAB5A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mnp04147]     132011760 (RAB5A)    04031 GTP-binding proteins [BR:mnp04031]     132011760 (RAB5A) Membrane trafficking [BR:mnp04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     132011760 (RAB5A)  Endosome - Lysosome transport     132011760 (RAB5A) Exosome [BR:mnp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    132011760 (RAB5A)   Exosomal proteins of other body fluids (saliva and urine)    132011760 (RAB5A)   Exosomal proteins of colorectal cancer cells    132011760 (RAB5A)   Exosomal proteins of bladder cancer cells    132011760 (RAB5A) GTP-binding proteins [BR:mnp04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     132011760 (RAB5A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 MCR_beta BrnT_toxin Motif Other DBs NCBI-GeneID:  132011760 NCBI-ProteinID:  XP_059246847 LinkDB All DBs Position 2:complement(83087474..83116112) Genome browser AA seq 215 aa AA seqDB search MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK LPKNEPQNPGANSARGRGVDLTEPTQPTRSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggctaatcgaggagcaacaagacccaacgggccaaatactggaaataaaatatgccag ttcaaactagtacttctgggagagtctgctgttgggaaatcaagcctagtgcttcgtttt gtgaagggccagtttcatgaatttcaagagagtaccataggggctgcttttctaacccaa actgtgtgtcttgatgacacaacagtaaagtttgaaatatgggatacagctggtcaagaa cgataccatagcctagcaccaatgtactacagaggagcacaagcagccatagttgtatat gatatcacaaacgaggagtcctttgccagagccaaaaactgggttaaagaacttcagagg caagccagtcctaacattgtaatagctttatcaggaaacaaggctgaccttgcaaataaa agagctgtcgatttccaggaagcacagtcctatgcagatgacaacagtttattattcatg gagacatcggccaaaacatcgatgaatgtaaatgaaatattcatggcaatagctaaaaag ttgccaaagaatgaaccacagaatccaggagcaaattctgcaagaggaagaggagtagac cttactgaacccacgcagccaaccaggagtcagtgttgtagtaactaa

DBGET integrated database retrieval system