Mustela nigripes (black-footed ferret): 132012135 Help Entry 132012135         CDS       T09425                                  Symbol PFN2 Name (RefSeq) profilin-2 isoform X1   KO K05759   profilin Organism mnp  Mustela nigripes (black-footed ferret) Pathway mnp04015   Rap1 signaling pathway mnp04810   Regulation of actin cytoskeleton mnp05014   Amyotrophic lateral sclerosis mnp05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mnp00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     132012135 (PFN2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     132012135 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     132012135 (PFN2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     132012135 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mnp04131]     132012135 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mnp04812]     132012135 (PFN2)    04147 Exosome [BR:mnp04147]     132012135 (PFN2) Membrane trafficking [BR:mnp04131]  Others   Actin-binding proteins    Others     132012135 (PFN2) Cytoskeleton proteins [BR:mnp04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      132012135 (PFN2) Exosome [BR:mnp04147]  Exosomal proteins   Proteins found in most exosomes    132012135 (PFN2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  132012135 NCBI-ProteinID:  XP_059247734 LinkDB All DBs Position 2:143801721..143807696 Genome browser AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH GGGLNKKAYSMAKYLRDSGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttc cagagcattacgccagtagaaatagatatgattgtaggaaaagaccgggaaggtttcttt accaacggtttgactcttggcgcaaagaagtgctcggtgatcagagatagcctatacgtc gatggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaac gttgctgtcggcagagctggtagagtcttggtctttgtaatgggaaaagaaggggtccat ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc tag

DBGET integrated database retrieval system