Mustela nigripes (black-footed ferret): 132015216 Help Entry 132015216         CDS       T09425                                  Name (RefSeq) probable protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism mnp  Mustela nigripes (black-footed ferret) Pathway mnp04810   Regulation of actin cytoskeleton mnp05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mnp00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     132015216  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     132015216 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CCDC53 Hydro_N_hd DUF7310 SPX Matrilin_ccoil MerR-DNA-bind DUF5617 LXG Motif Other DBs NCBI-GeneID:  132015216 NCBI-ProteinID:  XP_059251806 LinkDB All DBs Position 4:134471304..134471660 Genome browser AA seq 75 aa AA seqDB search MAGQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcaggtcaagaggatccagtgcagcgggagattcaccaggactgggcgaaccgagaa tacattgaggtcatcaccagcagcatcaagaaaatcgcggactttctcaactcattcgat atgtcttgtcgttcaagacttgcaacactaaacgaaaaattgacagccctcgaacggaga atagagtacattgaagcacgggtgacaaaaggtgagaccctcacctag

DBGET integrated database retrieval system