Mustela nigripes (black-footed ferret): 132015553 Help Entry 132015553         CDS       T09425                                  Symbol RHEB Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism mnp  Mustela nigripes (black-footed ferret) Pathway mnp04072   Phospholipase D signaling pathway mnp04140   Autophagy - animal mnp04150   mTOR signaling pathway mnp04151   PI3K-Akt signaling pathway mnp04152   AMPK signaling pathway mnp04211   Longevity regulating pathway mnp04218   Cellular senescence mnp04714   Thermogenesis mnp04910   Insulin signaling pathway mnp04919   Thyroid hormone signaling pathway mnp05163   Human cytomegalovirus infection mnp05165   Human papillomavirus infection mnp05168   Herpes simplex virus 1 infection mnp05231   Choline metabolism in cancer Brite KEGG Orthology (KO) [BR:mnp00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     132015553 (RHEB)    04151 PI3K-Akt signaling pathway     132015553 (RHEB)    04152 AMPK signaling pathway     132015553 (RHEB)    04150 mTOR signaling pathway     132015553 (RHEB)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     132015553 (RHEB)   09143 Cell growth and death    04218 Cellular senescence     132015553 (RHEB)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     132015553 (RHEB)    04919 Thyroid hormone signaling pathway     132015553 (RHEB)   09149 Aging    04211 Longevity regulating pathway     132015553 (RHEB)   09159 Environmental adaptation    04714 Thermogenesis     132015553 (RHEB)  09160 Human Diseases   09161 Cancer: overview    05231 Choline metabolism in cancer     132015553 (RHEB)   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     132015553 (RHEB)    05163 Human cytomegalovirus infection     132015553 (RHEB)    05165 Human papillomavirus infection     132015553 (RHEB)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:mnp04031]     132015553 (RHEB) GTP-binding proteins [BR:mnp04031]  Small (monomeric) G-proteins   Ras Family    Rheb     132015553 (RHEB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase SRPRB AAA_14 RhoGAP_pG1_pG2 DUF1842 Motif Other DBs NCBI-GeneID:  132015553 NCBI-ProteinID:  XP_059252057 LinkDB All DBs Position 4:5340352..5382259 Genome browser AA seq 184 aa AA seqDB search MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKIDGAASQGKSS CSVM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgccgcagtccaagtcccggaagatcgcgatcctgggctaccggtctgtggggaaatcc tcattgacgattcagtttgttgaaggccaatttgttgactcctacgacccaaccatagaa aacactttcacaaaattgatcacagtcaatggacaagaatatcatcttcaactcgttgac acagctgggcaggatgaatactccatctttcctcagacgtactccatagatattaatggc tatattcttgtgtattctgtgacatcaatcaaaagttttgaagtgattaaagttattcat ggcaaattgttggatatggtggggaaagtgcaaatacctattatgttggttgggaataag aaagacctccatatggaaagggtgatcagttatgaagaagggaaggccttagcagagtct tggaacgcagcttttttggaatcttctgctaaagaaaaccagacggccgttgacgttttt agaaggataattttggaggcagagaaaattgatggggccgcttcacaaggaaagtcgtcc tgctcggtgatgtaa

DBGET integrated database retrieval system