Mustela nigripes (black-footed ferret): 132015939 Help Entry 132015939         CDS       T09425                                  Symbol CXCL6 Name (RefSeq) C-X-C motif chemokine 6   KO K05506   C-X-C motif chemokine 5/6 Organism mnp  Mustela nigripes (black-footed ferret) Pathway mnp04060   Cytokine-cytokine receptor interaction mnp04061   Viral protein interaction with cytokine and cytokine receptor mnp04062   Chemokine signaling pathway mnp04657   IL-17 signaling pathway mnp04668   TNF signaling pathway mnp05133   Pertussis mnp05323   Rheumatoid arthritis Brite KEGG Orthology (KO) [BR:mnp00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     132015939 (CXCL6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     132015939 (CXCL6)    04061 Viral protein interaction with cytokine and cytokine receptor     132015939 (CXCL6)  09150 Organismal Systems   09151 Immune system    04657 IL-17 signaling pathway     132015939 (CXCL6)    04062 Chemokine signaling pathway     132015939 (CXCL6)  09160 Human Diseases   09171 Infectious disease: bacterial    05133 Pertussis     132015939 (CXCL6)   09163 Immune disease    05323 Rheumatoid arthritis     132015939 (CXCL6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mnp04052]     132015939 (CXCL6) Cytokines and neuropeptides [BR:mnp04052]  Cytokines   Chemokines    132015939 (CXCL6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  132015939 NCBI-ProteinID:  XP_059252824 LinkDB All DBs Position 1:261835078..261837517 Genome browser AA seq 117 aa AA seqDB search MSLPPSRAARVPGLSGSPCALLPLLLLLLLLTPPGPLARAGPVSTILRELRCVCLTTTPG IRPKMIAKVEVIAPGPQCSRVEVVATLKNKKEVCLDPENPVMKKVIQKILDSGRKTD NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgagcctcccgcccagccgcgccgcccgcgtcccgggcctctccggctcgccgtgcgcg ctgctgccgctgctgctgctgctgctgctgctgacgccgccggggcccctcgcccgcgcc ggtcccgtctcgaccatcctgagggagctgcgctgcgtgtgtctaaccaccacaccgggg atccggcccaagatgatcgctaaggtggaggtgatcgcccccgggccgcagtgctccagg gtggaagtcgtagccaccctgaagaacaagaaggaagtctgtctggacccggagaacccg gtgatgaagaaagtcatccagaaaattttggacagtggaagaaaaactgattaa

DBGET integrated database retrieval system