Mustela nigripes (black-footed ferret): 132015945 Help Entry 132015945         CDS       T09425                                  Symbol PPBP Name (RefSeq) platelet basic protein   KO K10029   platelet basic protein Organism mnp  Mustela nigripes (black-footed ferret) Pathway mnp04060   Cytokine-cytokine receptor interaction mnp04061   Viral protein interaction with cytokine and cytokine receptor mnp04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:mnp00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     132015945 (PPBP)    04061 Viral protein interaction with cytokine and cytokine receptor     132015945 (PPBP)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     132015945 (PPBP)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mnp04052]     132015945 (PPBP) Cytokines and neuropeptides [BR:mnp04052]  Cytokines   Chemokines    132015945 (PPBP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  132015945 NCBI-ProteinID:  XP_059252839 LinkDB All DBs Position 1:261847131..261849001 Genome browser AA seq 118 aa AA seqDB search MSCRRKATSSCPGTSPLRVLQGLFLLSLLLTLFPWTAGKTPSVDKKRFVELRCMCLNTVS GIHPSNIQSLEVLRAGPHCANVEVIATLRNGKEICLDPEAPKIKKIVQKILESSGSTA NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atgagctgcagacgtaaggccacctcctcctgtcccggcaccagccccctccgggtccta caggggctgttcctgctatccctgctcctgacgctgtttccctggactgctggaaaaact cccagtgtggacaagaagcggttcgttgaacttcgctgcatgtgcttgaataccgtctct ggcattcatccaagtaacatccaaagtttagaggtgctcagagcaggaccccattgtgcc aacgtcgaagtgatagccacactgaggaatgggaaggaaatctgcttggacccagaagct cccaaaatcaagaaaatagtccagaaaattttggaaagcagtgggtcaacagcttaa

DBGET integrated database retrieval system