Mustela nigripes (black-footed ferret): 132017677 Help Entry 132017677         CDS       T09425                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism mnp  Mustela nigripes (black-footed ferret) Pathway mnp04613   Neutrophil extracellular trap formation mnp05034   Alcoholism mnp05203   Viral carcinogenesis mnp05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mnp00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     132017677  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     132017677   09163 Immune disease    05322 Systemic lupus erythematosus     132017677   09165 Substance dependence    05034 Alcoholism     132017677  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mnp03036]     132017677 Chromosome and associated proteins [BR:mnp03036]  Eukaryotic type   Nucleosome assembly factors    Histones     132017677 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  132017677 NCBI-ProteinID:  XP_059255596 LinkDB All DBs Position 5:24563242..24564502 Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgcggcaagggcgggaagggcctgggcaaggggggcgccaagcgccaccgc aaggtgctgcgcgacaacatccagggcatcaccaagcccgccatccggcggctggcccgg cgcggcggcgtcaagcgcatctccggcctcatctacgaggagacccgcggggtgctcaag gtgttcctggagaacgtgatccgcgacgccgtcacctacacggagcacgccaagcgcaag acggtcacggccatggacgtggtctacgcgctcaagcgccagggccgcaccctctacggc ttcggcggttaa

DBGET integrated database retrieval system