Mustela nigripes (black-footed ferret): 132017716 Help Entry 132017716         CDS       T09425                                  Name (RefSeq) histone H2B type 1-K   KO K11252   histone H2B Organism mnp  Mustela nigripes (black-footed ferret) Pathway mnp04613   Neutrophil extracellular trap formation mnp05034   Alcoholism mnp05203   Viral carcinogenesis mnp05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mnp00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     132017716  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     132017716   09163 Immune disease    05322 Systemic lupus erythematosus     132017716   09165 Substance dependence    05034 Alcoholism     132017716  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mnp03036]     132017716   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mnp04147]     132017716 Chromosome and associated proteins [BR:mnp03036]  Eukaryotic type   Nucleosome assembly factors    Histones     132017716 Exosome [BR:mnp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    132017716 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  132017716 NCBI-ProteinID:  XP_059255670 LinkDB All DBs Position 5:25019993..25029124 Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSAK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgaacccgccaagtcggcgccggccccgaagaagggctccaagaaggcggtgacc aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtg tacgtgtacaaggtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggccatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcccgc ctggcgcactacaacaagcgctcgaccatcacgtccagggagatccagacggccgtgcgc ctgctgctgcccggggagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc aagtacaccagcgccaagtga

DBGET integrated database retrieval system