Mustela nigripes (black-footed ferret): 132017799 Help Entry 132017799         CDS       T09425                                  Symbol CSNK2B Name (RefSeq) casein kinase II subunit beta   KO K03115   casein kinase II subunit beta Organism mnp  Mustela nigripes (black-footed ferret) Pathway mnp03008   Ribosome biogenesis in eukaryotes mnp03083   Polycomb repressive complex mnp04064   NF-kappa B signaling pathway mnp04137   Mitophagy - animal mnp04310   Wnt signaling pathway mnp04520   Adherens junction mnp05010   Alzheimer disease mnp05020   Prion disease mnp05022   Pathways of neurodegeneration - multiple diseases mnp05162   Measles mnp05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:mnp00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     132017799 (CSNK2B)   09126 Chromosome    03083 Polycomb repressive complex     132017799 (CSNK2B)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     132017799 (CSNK2B)    04064 NF-kappa B signaling pathway     132017799 (CSNK2B)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     132017799 (CSNK2B)   09144 Cellular community - eukaryotes    04520 Adherens junction     132017799 (CSNK2B)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     132017799 (CSNK2B)   09172 Infectious disease: viral    05162 Measles     132017799 (CSNK2B)   09164 Neurodegenerative disease    05010 Alzheimer disease     132017799 (CSNK2B)    05020 Prion disease     132017799 (CSNK2B)    05022 Pathways of neurodegeneration - multiple diseases     132017799 (CSNK2B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:mnp03009]     132017799 (CSNK2B)    03036 Chromosome and associated proteins [BR:mnp03036]     132017799 (CSNK2B) Ribosome biogenesis [BR:mnp03009]  Eukaryotic type   90S particles    Kinase     132017799 (CSNK2B) Chromosome and associated proteins [BR:mnp03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.3/1.5)      132017799 (CSNK2B) SSDB OrthologParalogGFIT Motif Pfam:  CK_II_beta Motif Other DBs NCBI-GeneID:  132017799 NCBI-ProteinID:  XP_059255838 LinkDB All DBs Position 5:28250556..28254494 Genome browser AA seq 215 aa AA seqDB search MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML PIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPA NQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgagcagctcagaggaggtgtcttggatttcctggttttgtgggctccgtggcaatgaa tttttctgtgaagtggatgaggactacatccaggacaaattcaatctcactggactcaat gagcaggtgcctcactatcgacaagctctagacatgatcttggacctggagcctgatgaa gagctggaagacaaccccaaccagagcgacctgattgagcaggcagccgagatgctttat ggattgatccacgcccgctatatcctcaccaaccgtggcatcgcccagatgttggaaaag taccagcagggagactttggctactgtccccgtgtgtactgtgagaaccagccaatgctt cccatcggcctttcagacatcccaggtgaggccatggtgaagctctactgccccaagtgc atggacgtgtacacacccaagtcatcgaggcaccatcacacggacggcgcctacttcggc accggtttccctcacatgctcttcatggtgcaccccgagtaccggcctaagcggcccgcc aaccagtttgtgcccaggctctacggtttcaagatccatccaatggcctaccaactgcag ctccaagccgccagcaacttcaagagcccagtcaagacgattcgctga

DBGET integrated database retrieval system