Mustela nigripes (black-footed ferret): 132018427 Help Entry 132018427         CDS       T09425                                  Symbol DYNLT1 Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism mnp  Mustela nigripes (black-footed ferret) Pathway mnp04814   Motor proteins mnp05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mnp00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     132018427 (DYNLT1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     132018427 (DYNLT1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:mnp03037]     132018427 (DYNLT1)    04812 Cytoskeleton proteins [BR:mnp04812]     132018427 (DYNLT1) Cilium and associated proteins [BR:mnp03037]  Motile cilia and associated proteins   Dynein arm    132018427 (DYNLT1) Cytoskeleton proteins [BR:mnp04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      132018427 (DYNLT1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 P22_AR_C Motif Other DBs NCBI-GeneID:  132018427 NCBI-ProteinID:  XP_059257342 LinkDB All DBs Position 5:complement(141127030..141134611) Genome browser AA seq 113 aa AA seqDB search MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKP FKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggaagactaccaggctgcggaggagactgcttttgtcgtcgatgaagtgagcaacatt gtaaaagaggctatagagagcgcgatcggtggcaatgcctaccagcacagcaaagtgaat cagtggaccacaaacgtagtagaacaaactttaagccaactcaccaagctgggaaagcca tttaagtacatcgtgacctgtgtgattatgcagaagaacggagcggggctgcacacggcg agttcctgcttctgggacagctctacggacggcagctgcaccgtgcggtgggagaacaag accatgtactgcatcgtcagcgccttcgggctgtccatctga

DBGET integrated database retrieval system