Mustela nigripes (black-footed ferret): 132019782 Help Entry 132019782         CDS       T09425                                  Symbol RAB5B Name (RefSeq) ras-related protein Rab-5B   KO K07888   Ras-related protein Rab-5B Organism mnp  Mustela nigripes (black-footed ferret) Pathway mnp04014   Ras signaling pathway mnp04137   Mitophagy - animal mnp04144   Endocytosis mnp04145   Phagosome mnp04148   Efferocytosis mnp04962   Vasopressin-regulated water reabsorption mnp05132   Salmonella infection mnp05146   Amoebiasis mnp05152   Tuberculosis Brite KEGG Orthology (KO) [BR:mnp00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     132019782 (RAB5B)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     132019782 (RAB5B)    04145 Phagosome     132019782 (RAB5B)    04137 Mitophagy - animal     132019782 (RAB5B)    04148 Efferocytosis     132019782 (RAB5B)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     132019782 (RAB5B)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     132019782 (RAB5B)    05152 Tuberculosis     132019782 (RAB5B)   09174 Infectious disease: parasitic    05146 Amoebiasis     132019782 (RAB5B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mnp04131]     132019782 (RAB5B)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mnp04147]     132019782 (RAB5B)    04031 GTP-binding proteins [BR:mnp04031]     132019782 (RAB5B) Membrane trafficking [BR:mnp04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     132019782 (RAB5B)  Endosome - Lysosome transport     132019782 (RAB5B) Exosome [BR:mnp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    132019782 (RAB5B)   Exosomal proteins of other body fluids (saliva and urine)    132019782 (RAB5B)   Exosomal proteins of colorectal cancer cells    132019782 (RAB5B)   Exosomal proteins of melanoma cells    132019782 (RAB5B) GTP-binding proteins [BR:mnp04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     132019782 (RAB5B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  132019782 NCBI-ProteinID:  XP_059259353 LinkDB All DBs Position 6:91561049..91578524 Genome browser AA seq 215 aa AA seqDB search MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQ SVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQR QASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKK LPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgactagcagaagcacagccaggcccaatgggcagccccaggccagcaaaatatgccag ttcaaattggtcctgctgggtgaatctgcagtggggaagtctagcctggtattacgtttt gtcaaagggcagttccatgagtaccaagaaagcaccattggagcggccttcctcacccag tctgtttgtctagatgacacaacagtcaagtttgagatctgggacacagctgggcaggaa cgataccatagcttggcccccatgtactacagaggtgcccaagctgccattgtggtttat gacattactaatcaggaaaccttcgcccgagcgaagacatgggtaaaggaactacagcga caggccagtcctagcatcgttattgccctggcggggaacaaagctgacctggccaataag cgcatggtggagtatgaagaggcccaggcatatgcagatgacaacagcttattgtttatg gagacttcagccaagacagctatgaacgtgaatgatctcttcctggcaatagctaagaag ttgccaaagagtgaaccccagaatctggggggtgcagcaggccgaagccggggtgtggat cttcatgaacagtcccagcagaacaagagccagtgttgtagcaactga

DBGET integrated database retrieval system