Mustela nigripes (black-footed ferret): 132021817 Help Entry 132021817         CDS       T09425                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1 isoform X1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism mnp  Mustela nigripes (black-footed ferret) Pathway mnp01521   EGFR tyrosine kinase inhibitor resistance mnp01524   Platinum drug resistance mnp04014   Ras signaling pathway mnp04064   NF-kappa B signaling pathway mnp04115   p53 signaling pathway mnp04137   Mitophagy - animal mnp04140   Autophagy - animal mnp04151   PI3K-Akt signaling pathway mnp04210   Apoptosis mnp04215   Apoptosis - multiple species mnp04621   NOD-like receptor signaling pathway mnp04630   JAK-STAT signaling pathway mnp05012   Parkinson disease mnp05014   Amyotrophic lateral sclerosis mnp05022   Pathways of neurodegeneration - multiple diseases mnp05145   Toxoplasmosis mnp05162   Measles mnp05166   Human T-cell leukemia virus 1 infection mnp05168   Herpes simplex virus 1 infection mnp05170   Human immunodeficiency virus 1 infection mnp05200   Pathways in cancer mnp05202   Transcriptional misregulation in cancer mnp05212   Pancreatic cancer mnp05220   Chronic myeloid leukemia mnp05222   Small cell lung cancer mnp05225   Hepatocellular carcinoma mnp05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mnp00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     132021817 (BCL2L1)    04630 JAK-STAT signaling pathway     132021817 (BCL2L1)    04064 NF-kappa B signaling pathway     132021817 (BCL2L1)    04151 PI3K-Akt signaling pathway     132021817 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     132021817 (BCL2L1)    04137 Mitophagy - animal     132021817 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     132021817 (BCL2L1)    04215 Apoptosis - multiple species     132021817 (BCL2L1)    04115 p53 signaling pathway     132021817 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     132021817 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     132021817 (BCL2L1)    05202 Transcriptional misregulation in cancer     132021817 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     132021817 (BCL2L1)    05225 Hepatocellular carcinoma     132021817 (BCL2L1)    05220 Chronic myeloid leukemia     132021817 (BCL2L1)    05222 Small cell lung cancer     132021817 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     132021817 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     132021817 (BCL2L1)    05162 Measles     132021817 (BCL2L1)    05168 Herpes simplex virus 1 infection     132021817 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     132021817 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     132021817 (BCL2L1)    05014 Amyotrophic lateral sclerosis     132021817 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     132021817 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     132021817 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     132021817 (BCL2L1)    01524 Platinum drug resistance     132021817 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mnp01009]     132021817 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mnp03036]     132021817 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:mnp02000]     132021817 (BCL2L1) Protein phosphatases and associated proteins [BR:mnp01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      132021817 (BCL2L1) Chromosome and associated proteins [BR:mnp03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     132021817 (BCL2L1) Transporters [BR:mnp02000]  Other transporters   Pores ion channels [TC:1]    132021817 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  132021817 NCBI-ProteinID:  XP_059262722 LinkDB All DBs Position 7:complement(114307556..114357949) Genome browser AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDAEENRTEAPEGTESEMETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQALVSRIATWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagtttagtgatgcagaagagaacagaactgaggccccagaaggg actgaatcagagatggagacccccagtgccatcaatggcaacccatcctggcacttggcg gacagccctgcggtgaatggagccactggccacagcagcagcttggatgcccgggaggtg atccccatggcagcggtaaagcaagcgctgagggaggctggggatgagtttgaactgagg taccggcgggcattcagcgacctgacatctcagcttcacatcaccccagggacagcgtat cagagctttgagcaggtggtgaacgaactcttccgggatggggtgaactggggtcgcatt gtggcctttttctccttcggtggggctctgtgtgtggagagcgtagacaaggagatgcag gcattggtgagtcggatcgcaacttggatggccacttacctgaacgaccacctagagcct tggatccaggagaacggcggctgggacactttcgtggaactctacgggaacaatgcagca gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacaggcatgactgtg gctggcgtggttctgctgggctcactcttcagtcggaaatga

DBGET integrated database retrieval system