Mustela nigripes (black-footed ferret): 132022642 Help Entry 132022642         CDS       T09425                                  Symbol NXT1 Name (RefSeq) NTF2-related export protein 1   KO K14285   NTF2-related export protein 1/2 Organism mnp  Mustela nigripes (black-footed ferret) Pathway mnp03008   Ribosome biogenesis in eukaryotes mnp03013   Nucleocytoplasmic transport mnp03015   mRNA surveillance pathway mnp05014   Amyotrophic lateral sclerosis mnp05164   Influenza A Brite KEGG Orthology (KO) [BR:mnp00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     132022642 (NXT1)    03015 mRNA surveillance pathway     132022642 (NXT1)    03008 Ribosome biogenesis in eukaryotes     132022642 (NXT1)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     132022642 (NXT1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     132022642 (NXT1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:mnp03019]     132022642 (NXT1)    03009 Ribosome biogenesis [BR:mnp03009]     132022642 (NXT1) Messenger RNA biogenesis [BR:mnp03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Nuclear pore complex      132022642 (NXT1) Ribosome biogenesis [BR:mnp03009]  Eukaryotic type   Pre-60S particles    Export and cytoplasmic maturation factors     132022642 (NXT1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NTF2 NXF_NTF2 Glyco_tran_10_N Cofilin_ADF Motif Other DBs NCBI-GeneID:  132022642 NCBI-ProteinID:  XP_059263867 LinkDB All DBs Position 7:complement(92675686..92679096) Genome browser AA seq 140 aa AA seqDB search MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSE FFEMLPSSEFQINVVDCQPVHDEATPSQTTVLVVICGTVKFEGNKQRDFNQNFILTAQAS PSNTVWKIASDCFRFQDWAS NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggcatccgtggacttcaagacctacgtggatcaggcctgcagagctgctgaggagttt gtgaatgtgtactacaccaccatggacaaacgacggcgtctgctgtcccgcctgtacatg ggcacggccaccctggtgtggaacggaaacgctgtttcaggacaagaatccttgagtgag ttttttgaaatgttaccttccagtgagttccaaatcaacgtggtagactgccagcctgtc catgatgaagccaccccgagccagaccacagtccttgttgtgatctgtggaacagtgaag tttgaaggcaacaaacaacgggactttaaccaaaacttcattctgactgcccaggcctca cccagcaacacggtgtggaagatagcaagtgactgcttccggttccaagactgggccagc tag

DBGET integrated database retrieval system