Mustela nigripes (black-footed ferret): 132022742 Help Entry 132022742         CDS       T09425                                  Symbol GHRH Name (RefSeq) somatoliberin   KO K05260   growth hormone-releasing hormone Organism mnp  Mustela nigripes (black-footed ferret) Pathway mnp04080   Neuroactive ligand-receptor interaction mnp04081   Hormone signaling mnp04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:mnp00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     132022742 (GHRH)    04081 Hormone signaling     132022742 (GHRH)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     132022742 (GHRH)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mnp04052]     132022742 (GHRH) Cytokines and neuropeptides [BR:mnp04052]  Neuropeptides   GPCR binding    132022742 (GHRH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hormone_2 Motif Other DBs NCBI-GeneID:  132022742 NCBI-ProteinID:  XP_059263958 LinkDB All DBs Position 7:complement(119044922..119063374) Genome browser AA seq 104 aa AA seqDB search MLLWVFFLVILTLSSDSHSSPTSLPLRVPRNADAIFTNNYRKLLSQLSARKLLLDIMSRQ QGEENWEQGAKARLGRQVDSMWAGAKQTPLESTLAAMLQKQRNS NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgctgctctgggtgttcttcctggtgatcctcactctcagcagtgactcccactcttcc ccaacgtccctgcccctcagagtccctcggaatgcagacgccatcttcacgaacaactac cggaagctgctgagccagctgtcagcccgcaagctactgctcgacatcatgagccgccag cagggagaggaaaactgggagcaaggagcaaaggcacggctcggtcgtcaggtggacagt atgtgggcaggcgcaaagcagacgcccctggagagcaccctggcggccatgttgcagaag cagaggaattcctga

DBGET integrated database retrieval system