Mustela nigripes (black-footed ferret): 132025071 Help Entry 132025071         CDS       T09425                                  Symbol PPP3R2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism mnp  Mustela nigripes (black-footed ferret) Pathway mnp04010   MAPK signaling pathway mnp04020   Calcium signaling pathway mnp04022   cGMP-PKG signaling pathway mnp04114   Oocyte meiosis mnp04218   Cellular senescence mnp04310   Wnt signaling pathway mnp04360   Axon guidance mnp04370   VEGF signaling pathway mnp04380   Osteoclast differentiation mnp04625   C-type lectin receptor signaling pathway mnp04650   Natural killer cell mediated cytotoxicity mnp04658   Th1 and Th2 cell differentiation mnp04659   Th17 cell differentiation mnp04660   T cell receptor signaling pathway mnp04662   B cell receptor signaling pathway mnp04720   Long-term potentiation mnp04724   Glutamatergic synapse mnp04921   Oxytocin signaling pathway mnp04922   Glucagon signaling pathway mnp04924   Renin secretion mnp05010   Alzheimer disease mnp05014   Amyotrophic lateral sclerosis mnp05020   Prion disease mnp05022   Pathways of neurodegeneration - multiple diseases mnp05031   Amphetamine addiction mnp05152   Tuberculosis mnp05163   Human cytomegalovirus infection mnp05166   Human T-cell leukemia virus 1 infection mnp05167   Kaposi sarcoma-associated herpesvirus infection mnp05170   Human immunodeficiency virus 1 infection mnp05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mnp05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mnp00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     132025071 (PPP3R2)    04022 cGMP-PKG signaling pathway     132025071 (PPP3R2)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     132025071 (PPP3R2)    04660 T cell receptor signaling pathway     132025071 (PPP3R2)    04658 Th1 and Th2 cell differentiation     132025071 (PPP3R2)    04659 Th17 cell differentiation     132025071 (PPP3R2)    04662 B cell receptor signaling pathway     132025071 (PPP3R2)   09152 Endocrine system    04922 Glucagon signaling pathway     132025071 (PPP3R2)    04921 Oxytocin signaling pathway     132025071 (PPP3R2)    04924 Renin secretion     132025071 (PPP3R2)   09156 Nervous system    04724 Glutamatergic synapse     132025071 (PPP3R2)    04720 Long-term potentiation     132025071 (PPP3R2)   09158 Development and regeneration    04360 Axon guidance     132025071 (PPP3R2)    04380 Osteoclast differentiation     132025071 (PPP3R2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     132025071 (PPP3R2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     132025071 (PPP3R2)    05170 Human immunodeficiency virus 1 infection     132025071 (PPP3R2)    05163 Human cytomegalovirus infection     132025071 (PPP3R2)    05167 Kaposi sarcoma-associated herpesvirus infection     132025071 (PPP3R2)   09171 Infectious disease: bacterial    05152 Tuberculosis     132025071 (PPP3R2)   09164 Neurodegenerative disease    05010 Alzheimer disease     132025071 (PPP3R2)    05014 Amyotrophic lateral sclerosis     132025071 (PPP3R2)    05020 Prion disease     132025071 (PPP3R2)    05022 Pathways of neurodegeneration - multiple diseases     132025071 (PPP3R2)   09165 Substance dependence    05031 Amphetamine addiction     132025071 (PPP3R2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     132025071 (PPP3R2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mnp01009]     132025071 (PPP3R2) Protein phosphatases and associated proteins [BR:mnp01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      132025071 (PPP3R2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_9 YtfJ_HI0045 Toprim_3 Motif Other DBs NCBI-GeneID:  132025071 NCBI-ProteinID:  XP_059268230 LinkDB All DBs Position 9:29621767..29622534 Genome browser AA seq 170 aa AA seqDB search MGNEASYPEEICSHFSSDEIKRLSKRFKKLDLDRSGSLSVEEFVSLPELHQNPLVQRVVD VFDTDGNGEVNFKEFILGTSQFSVRGDEEEKLRFAFSIYDIDKDGYISNGELFQVLKLMV GDNLEDWQLQQLVDKTIIVLDRDGDGKISFEEFSAVVRGLDVHKKLVVIV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaagccagttacccggaggagatatgctcccacttcagctccgatgaaatt aaaaggctgagcaagaggtttaagaagctggacttggaccgttcaggctctctgagcgtg gaggagttcgtgtccctgcccgagctgcaccagaacccgttggtgcagcgagtggtcgac gtcttcgacaccgacggcaatggagaagtgaacttcaaggagttcatcctggggacctcc cagttcagcgtcaggggggacgaggaggagaagttgaggtttgcgttcagcatctatgac attgataaagatggctacatttccaacggggagctcttccaggtgctgaagctgatggtg ggcgacaacctggaggactggcagttacagcagttagtggacaaaaccatcatcgtcctg gatcgggatggagacgggaaaatatcctttgaggagttcagcgctgtggttagaggcctg gatgtccacaagaagttggtggtgattgtgtga

DBGET integrated database retrieval system