KEGG   Mustela nigripes (black-footed ferret): 132026755
Entry
132026755         CDS       T09425                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
mnp  Mustela nigripes (black-footed ferret)
Pathway
mnp01521  EGFR tyrosine kinase inhibitor resistance
mnp01522  Endocrine resistance
mnp01524  Platinum drug resistance
mnp04010  MAPK signaling pathway
mnp04012  ErbB signaling pathway
mnp04014  Ras signaling pathway
mnp04015  Rap1 signaling pathway
mnp04022  cGMP-PKG signaling pathway
mnp04024  cAMP signaling pathway
mnp04062  Chemokine signaling pathway
mnp04066  HIF-1 signaling pathway
mnp04068  FoxO signaling pathway
mnp04071  Sphingolipid signaling pathway
mnp04072  Phospholipase D signaling pathway
mnp04114  Oocyte meiosis
mnp04140  Autophagy - animal
mnp04148  Efferocytosis
mnp04150  mTOR signaling pathway
mnp04151  PI3K-Akt signaling pathway
mnp04210  Apoptosis
mnp04218  Cellular senescence
mnp04261  Adrenergic signaling in cardiomyocytes
mnp04270  Vascular smooth muscle contraction
mnp04350  TGF-beta signaling pathway
mnp04360  Axon guidance
mnp04370  VEGF signaling pathway
mnp04371  Apelin signaling pathway
mnp04380  Osteoclast differentiation
mnp04510  Focal adhesion
mnp04517  IgSF CAM signaling
mnp04520  Adherens junction
mnp04540  Gap junction
mnp04550  Signaling pathways regulating pluripotency of stem cells
mnp04611  Platelet activation
mnp04613  Neutrophil extracellular trap formation
mnp04620  Toll-like receptor signaling pathway
mnp04621  NOD-like receptor signaling pathway
mnp04625  C-type lectin receptor signaling pathway
mnp04650  Natural killer cell mediated cytotoxicity
mnp04657  IL-17 signaling pathway
mnp04658  Th1 and Th2 cell differentiation
mnp04659  Th17 cell differentiation
mnp04660  T cell receptor signaling pathway
mnp04662  B cell receptor signaling pathway
mnp04664  Fc epsilon RI signaling pathway
mnp04666  Fc gamma R-mediated phagocytosis
mnp04668  TNF signaling pathway
mnp04713  Circadian entrainment
mnp04720  Long-term potentiation
mnp04722  Neurotrophin signaling pathway
mnp04723  Retrograde endocannabinoid signaling
mnp04724  Glutamatergic synapse
mnp04725  Cholinergic synapse
mnp04726  Serotonergic synapse
mnp04730  Long-term depression
mnp04810  Regulation of actin cytoskeleton
mnp04910  Insulin signaling pathway
mnp04912  GnRH signaling pathway
mnp04914  Progesterone-mediated oocyte maturation
mnp04915  Estrogen signaling pathway
mnp04916  Melanogenesis
mnp04917  Prolactin signaling pathway
mnp04919  Thyroid hormone signaling pathway
mnp04921  Oxytocin signaling pathway
mnp04926  Relaxin signaling pathway
mnp04928  Parathyroid hormone synthesis, secretion and action
mnp04929  GnRH secretion
mnp04930  Type II diabetes mellitus
mnp04933  AGE-RAGE signaling pathway in diabetic complications
mnp04934  Cushing syndrome
mnp04935  Growth hormone synthesis, secretion and action
mnp04960  Aldosterone-regulated sodium reabsorption
mnp05010  Alzheimer disease
mnp05020  Prion disease
mnp05022  Pathways of neurodegeneration - multiple diseases
mnp05034  Alcoholism
mnp05132  Salmonella infection
mnp05133  Pertussis
mnp05135  Yersinia infection
mnp05140  Leishmaniasis
mnp05142  Chagas disease
mnp05145  Toxoplasmosis
mnp05152  Tuberculosis
mnp05160  Hepatitis C
mnp05161  Hepatitis B
mnp05163  Human cytomegalovirus infection
mnp05164  Influenza A
mnp05165  Human papillomavirus infection
mnp05166  Human T-cell leukemia virus 1 infection
mnp05167  Kaposi sarcoma-associated herpesvirus infection
mnp05170  Human immunodeficiency virus 1 infection
mnp05171  Coronavirus disease - COVID-19
mnp05200  Pathways in cancer
mnp05203  Viral carcinogenesis
mnp05205  Proteoglycans in cancer
mnp05206  MicroRNAs in cancer
mnp05207  Chemical carcinogenesis - receptor activation
mnp05208  Chemical carcinogenesis - reactive oxygen species
mnp05210  Colorectal cancer
mnp05211  Renal cell carcinoma
mnp05212  Pancreatic cancer
mnp05213  Endometrial cancer
mnp05214  Glioma
mnp05215  Prostate cancer
mnp05216  Thyroid cancer
mnp05218  Melanoma
mnp05219  Bladder cancer
mnp05220  Chronic myeloid leukemia
mnp05221  Acute myeloid leukemia
mnp05223  Non-small cell lung cancer
mnp05224  Breast cancer
mnp05225  Hepatocellular carcinoma
mnp05226  Gastric cancer
mnp05230  Central carbon metabolism in cancer
mnp05231  Choline metabolism in cancer
mnp05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mnp05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mnp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    132026755 (MAPK3)
   04012 ErbB signaling pathway
    132026755 (MAPK3)
   04014 Ras signaling pathway
    132026755 (MAPK3)
   04015 Rap1 signaling pathway
    132026755 (MAPK3)
   04350 TGF-beta signaling pathway
    132026755 (MAPK3)
   04370 VEGF signaling pathway
    132026755 (MAPK3)
   04371 Apelin signaling pathway
    132026755 (MAPK3)
   04668 TNF signaling pathway
    132026755 (MAPK3)
   04066 HIF-1 signaling pathway
    132026755 (MAPK3)
   04068 FoxO signaling pathway
    132026755 (MAPK3)
   04072 Phospholipase D signaling pathway
    132026755 (MAPK3)
   04071 Sphingolipid signaling pathway
    132026755 (MAPK3)
   04024 cAMP signaling pathway
    132026755 (MAPK3)
   04022 cGMP-PKG signaling pathway
    132026755 (MAPK3)
   04151 PI3K-Akt signaling pathway
    132026755 (MAPK3)
   04150 mTOR signaling pathway
    132026755 (MAPK3)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    132026755 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    132026755 (MAPK3)
   04148 Efferocytosis
    132026755 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    132026755 (MAPK3)
   04210 Apoptosis
    132026755 (MAPK3)
   04218 Cellular senescence
    132026755 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    132026755 (MAPK3)
   04520 Adherens junction
    132026755 (MAPK3)
   04540 Gap junction
    132026755 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    132026755 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    132026755 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    132026755 (MAPK3)
   04613 Neutrophil extracellular trap formation
    132026755 (MAPK3)
   04620 Toll-like receptor signaling pathway
    132026755 (MAPK3)
   04621 NOD-like receptor signaling pathway
    132026755 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    132026755 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    132026755 (MAPK3)
   04660 T cell receptor signaling pathway
    132026755 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    132026755 (MAPK3)
   04659 Th17 cell differentiation
    132026755 (MAPK3)
   04657 IL-17 signaling pathway
    132026755 (MAPK3)
   04662 B cell receptor signaling pathway
    132026755 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    132026755 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    132026755 (MAPK3)
   04062 Chemokine signaling pathway
    132026755 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    132026755 (MAPK3)
   04929 GnRH secretion
    132026755 (MAPK3)
   04912 GnRH signaling pathway
    132026755 (MAPK3)
   04915 Estrogen signaling pathway
    132026755 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    132026755 (MAPK3)
   04917 Prolactin signaling pathway
    132026755 (MAPK3)
   04921 Oxytocin signaling pathway
    132026755 (MAPK3)
   04926 Relaxin signaling pathway
    132026755 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    132026755 (MAPK3)
   04919 Thyroid hormone signaling pathway
    132026755 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    132026755 (MAPK3)
   04916 Melanogenesis
    132026755 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    132026755 (MAPK3)
   04270 Vascular smooth muscle contraction
    132026755 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    132026755 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    132026755 (MAPK3)
   04725 Cholinergic synapse
    132026755 (MAPK3)
   04726 Serotonergic synapse
    132026755 (MAPK3)
   04720 Long-term potentiation
    132026755 (MAPK3)
   04730 Long-term depression
    132026755 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    132026755 (MAPK3)
   04722 Neurotrophin signaling pathway
    132026755 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    132026755 (MAPK3)
   04380 Osteoclast differentiation
    132026755 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    132026755 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    132026755 (MAPK3)
   05206 MicroRNAs in cancer
    132026755 (MAPK3)
   05205 Proteoglycans in cancer
    132026755 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    132026755 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    132026755 (MAPK3)
   05203 Viral carcinogenesis
    132026755 (MAPK3)
   05230 Central carbon metabolism in cancer
    132026755 (MAPK3)
   05231 Choline metabolism in cancer
    132026755 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    132026755 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    132026755 (MAPK3)
   05212 Pancreatic cancer
    132026755 (MAPK3)
   05225 Hepatocellular carcinoma
    132026755 (MAPK3)
   05226 Gastric cancer
    132026755 (MAPK3)
   05214 Glioma
    132026755 (MAPK3)
   05216 Thyroid cancer
    132026755 (MAPK3)
   05221 Acute myeloid leukemia
    132026755 (MAPK3)
   05220 Chronic myeloid leukemia
    132026755 (MAPK3)
   05218 Melanoma
    132026755 (MAPK3)
   05211 Renal cell carcinoma
    132026755 (MAPK3)
   05219 Bladder cancer
    132026755 (MAPK3)
   05215 Prostate cancer
    132026755 (MAPK3)
   05213 Endometrial cancer
    132026755 (MAPK3)
   05224 Breast cancer
    132026755 (MAPK3)
   05223 Non-small cell lung cancer
    132026755 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    132026755 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    132026755 (MAPK3)
   05161 Hepatitis B
    132026755 (MAPK3)
   05160 Hepatitis C
    132026755 (MAPK3)
   05171 Coronavirus disease - COVID-19
    132026755 (MAPK3)
   05164 Influenza A
    132026755 (MAPK3)
   05163 Human cytomegalovirus infection
    132026755 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    132026755 (MAPK3)
   05165 Human papillomavirus infection
    132026755 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    132026755 (MAPK3)
   05135 Yersinia infection
    132026755 (MAPK3)
   05133 Pertussis
    132026755 (MAPK3)
   05152 Tuberculosis
    132026755 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    132026755 (MAPK3)
   05140 Leishmaniasis
    132026755 (MAPK3)
   05142 Chagas disease
    132026755 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    132026755 (MAPK3)
   05020 Prion disease
    132026755 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    132026755 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    132026755 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    132026755 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    132026755 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    132026755 (MAPK3)
   04934 Cushing syndrome
    132026755 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    132026755 (MAPK3)
   01524 Platinum drug resistance
    132026755 (MAPK3)
   01522 Endocrine resistance
    132026755 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mnp01001]
    132026755 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mnp03036]
    132026755 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mnp04147]
    132026755 (MAPK3)
Enzymes [BR:mnp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     132026755 (MAPK3)
Protein kinases [BR:mnp01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   132026755 (MAPK3)
Chromosome and associated proteins [BR:mnp03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     132026755 (MAPK3)
Exosome [BR:mnp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   132026755 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 132026755
NCBI-ProteinID: XP_059270971
LinkDB
Position
11:complement(16712327..16718954)
AA seq 379 aa
MAAAAAQGGGGGEPRGADGVGPGVSGEVEVVKGQPFDVGPRYTELHYIGEGAYGMVSSAY
DHVRKVRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVYI
VQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDL
KICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS
NRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWSKLFPKSD
SKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPSDEPVAEEPFTFDMELDDLPKERL
KELIFQETARFQPGAREAP
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggctcaggggggcgggggcggggagccgcggggagccgatggggtc
ggcccgggggtctcgggggaggtggaggtggtgaaggggcagccgttcgacgtgggcccg
cgctacacggagctgcattacatcggcgagggcgcgtacggcatggtcagctcagcttac
gaccacgtgcgcaaggttcgcgtggccatcaagaaaatcagccccttcgagcatcagacc
tactgccagcgcacactgcgagagatccagatcttactgcgcttccgccacgagaacgtc
attggcattcgggatattctgcgggcgcccaccctggaagccatgagggatgtctacatt
gtgcaggacctgatggagaccgacctctacaaattgctcaaaagccagcagctgagcaac
gaccatatttgctacttcctctaccagatcctgcggggcctgaagtatatccactcggcc
aacgtgctccaccgggatttgaagccctctaacctgctcatcaacaccacctgcgacctt
aagatctgcgattttggcctggcccggattgccgatcccgagcacgaccacactggcttc
ctgacagagtatgtggccacacgctggtaccgggctccagaaatcatgcttaactctaag
ggctacaccaagtccatcgacatctggtctgtgggctgcattctggctgagatgctctcc
aaccggcccatcttccctggcaagcactacctggaccagctcaaccacattctgggtatc
ctgggctccccgtcccaggaggacttgaactgtatcatcaacatgaaggcccggaactac
ctgcagtctctgccctccaagaccaaggtggcctggtccaagcttttccccaagtccgac
tccaaagctcttgacctgctagaccggatgttgaccttcaaccccaacaaacgaatcaca
gtggaagaagccctggctcacccctacttggagcagtactacgatccaagtgatgagcca
gtggccgaggagcctttcaccttcgacatggagctggatgacctacccaaggagcggctg
aaggagctcatcttccaggagacagcccgcttccagcctggggcgcgggaggccccctaa

DBGET integrated database retrieval system