Mustela nigripes (black-footed ferret): 132027157 Help Entry 132027157         CDS       T09425                                  Symbol CCL24 Name (RefSeq) C-C motif chemokine 24   KO K21097   C-C motif chemokine 24 Organism mnp  Mustela nigripes (black-footed ferret) Pathway mnp04060   Cytokine-cytokine receptor interaction mnp04061   Viral protein interaction with cytokine and cytokine receptor mnp04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:mnp00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     132027157 (CCL24)    04061 Viral protein interaction with cytokine and cytokine receptor     132027157 (CCL24)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     132027157 (CCL24)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mnp04052]     132027157 (CCL24) Cytokines and neuropeptides [BR:mnp04052]  Cytokines   Chemokines    132027157 (CCL24) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  132027157 NCBI-ProteinID:  XP_059271916 LinkDB All DBs Position 11:9024426..9027026 Genome browser AA seq 119 aa AA seqDB search MAGLATLGAGLLLLTLCAHCIAPAGSAPVPSSCCMSFISKKVPENRVVSYQLSSASVCPM AGVIFTTRKGQKFCGDPKEHWVQTYMTKLDTRRKKASRGVRAMTAKAPVRGKPANTTAI NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggcaggccttgcgaccctgggggctggcctcctgctcctgaccctgtgtgcccactgc atcgcccctgcaggctccgcacccgtcccctcctcctgctgcatgtccttcatttccaag aaagttcctgagaaccgagtggtgagctaccagctgtccagtgcgagcgtctgccctatg gcaggagtgatcttcaccaccaggaagggccagaagttctgcggggaccccaaggagcac tgggtccagacgtacatgacgaagctggacaccaggcggaagaaggcgtcccgtggggtc cgggcaatgaccgccaaagccccagtgcgggggaagccagccaacaccaccgccatctag

DBGET integrated database retrieval system