Mustela nigripes (black-footed ferret): 132027867 Help Entry 132027867         CDS       T09425                                  Symbol IL5 Name (RefSeq) interleukin-5   KO K05428   interleukin 5 Organism mnp  Mustela nigripes (black-footed ferret) Pathway mnp04060   Cytokine-cytokine receptor interaction mnp04630   JAK-STAT signaling pathway mnp04640   Hematopoietic cell lineage mnp04657   IL-17 signaling pathway mnp04658   Th1 and Th2 cell differentiation mnp04660   T cell receptor signaling pathway mnp04664   Fc epsilon RI signaling pathway mnp04672   Intestinal immune network for IgA production mnp05200   Pathways in cancer mnp05310   Asthma mnp05320   Autoimmune thyroid disease mnp05321   Inflammatory bowel disease mnp05330   Allograft rejection Brite KEGG Orthology (KO) [BR:mnp00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     132027867 (IL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     132027867 (IL5)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     132027867 (IL5)    04660 T cell receptor signaling pathway     132027867 (IL5)    04658 Th1 and Th2 cell differentiation     132027867 (IL5)    04657 IL-17 signaling pathway     132027867 (IL5)    04664 Fc epsilon RI signaling pathway     132027867 (IL5)    04672 Intestinal immune network for IgA production     132027867 (IL5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     132027867 (IL5)   09163 Immune disease    05310 Asthma     132027867 (IL5)    05320 Autoimmune thyroid disease     132027867 (IL5)    05321 Inflammatory bowel disease     132027867 (IL5)    05330 Allograft rejection     132027867 (IL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mnp04052]     132027867 (IL5)    00536 Glycosaminoglycan binding proteins [BR:mnp00536]     132027867 (IL5) Cytokines and neuropeptides [BR:mnp04052]  Cytokines   Interleukins    132027867 (IL5) Glycosaminoglycan binding proteins [BR:mnp00536]  Heparan sulfate / Heparin   Cytokines    132027867 (IL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL5 Motif Other DBs NCBI-GeneID:  132027867 NCBI-ProteinID:  XP_059272574 LinkDB All DBs Position 12:complement(70236315..70238318) Genome browser AA seq 134 aa AA seqDB search MRLLLHLSLLALGAAYVSVTPVEDPMNRLVAETLTLLSTHRTLLIGDGNLMIPTPENKNH QLCIEEVFQGIDILKNRTAQAAAVDKLFQNLSFIKAHIDSQKKKCGGERWRVKKFLDYLQ VFLGVINTEWTTES NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgagactgcttctgcatttgagtttgctagctcttggggctgcctatgtttctgtcact cctgtagaagatcccatgaacagattggtggcagagaccttgacactgctctccactcat cgaactctgctgataggtgacgggaacctgatgattcctactcctgaaaataaaaatcac caactgtgcatcgaagaagtctttcagggtatagacatattaaagaaccgaactgcacaa gcagcggctgtggataaactattccaaaatttgtctttcataaaagcacatatagacagc caaaaaaaaaaatgtggaggagaaagatggagagtaaaaaagttcctagactacctgcaa gtgtttcttggtgtcataaacactgagtggacaacagaaagttga

DBGET integrated database retrieval system