Massilia sp. NR 4-1: ACZ75_06440 Help Entry ACZ75_06440       CDS       T04026                                  Name (GenBank) hypothetical protein   KO K02408   flagellar hook-basal body complex protein FliE Organism mnr  Massilia sp. NR 4-1 Pathway mnr02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:mnr00001]  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     ACZ75_06440  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:mnr02035]     ACZ75_06440 Bacterial motility proteins [BR:mnr02035]  Flagellar system   Flagellar assembly proteins    Rod and hook     ACZ75_06440 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FliE Motif Other DBs NCBI-ProteinID:  AKU21173 UniProt:  A0A0K1JW40 LinkDB All DBs Position complement(1783980..1784288) Genome browser AA seq 102 aa AA seqDB search MIEAIAAIGASAELAALAPAATSGAAAPAAPGFATWFSEQVGQVNTTLVQTDHEVQALAA GEAGSLHEVMIHLEEAKLSFQLLAQVRNRMLEAYQEVMRMQV NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgatcgaagcgatcgccgccatcggcgccagcgccgagctggcagcactggcgcccgcc gccaccagcggcgctgcggcgcccgccgcgccgggctttgccacctggttcagcgagcag gtggggcaggtgaataccaccctggtgcagaccgaccacgaggtgcaggccctggccgcc ggcgaagcgggcagcctgcacgaggtgatgatccatctggaagaggccaagctgtccttc cagctgctggcccaggtgcgcaaccgcatgctggaagcctaccaagaagttatgcggatg caggtttag

DBGET integrated database retrieval system