Massilia sp. NR 4-1: ACZ75_25675 Help Entry ACZ75_25675       CDS       T04026                                  Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism mnr  Massilia sp. NR 4-1 Brite KEGG Orthology (KO) [BR:mnr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mnr03036]     ACZ75_25675 Chromosome and associated proteins [BR:mnr03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     ACZ75_25675 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC TolA_bind_tri FlaC_arch Motif Other DBs NCBI-ProteinID:  AKU24344 UniProt:  A0A0K1K4Q1 LinkDB All DBs Position 6092052..6092366 Genome browser AA seq 104 aa AA seqDB search MRLITLSLALLLVLIQYPLWLGKGGWLRVGELEEQVAAAHKKNEELERRNAKLDSEVRDL KDGTGAVEERARYELSMIKQNEIYVQILGKGQTRPAPDAANPTP NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgcgcctgatcaccctctccctcgccctgctgcttgtgctgatccagtaccccctgtgg ctgggcaaaggcggctggctgcgcgtcggcgaactcgaagagcaggtcgccgcggcccac aagaagaacgaggaactggaacgccgcaacgccaagctcgactccgaagtgcgcgacctg aaagacggcaccggcgccgtcgaggaacgcgcccgctacgagctcagcatgatcaagcaa aacgagatctacgtgcagatcctcggcaagggccagacccgtcccgcccctgacgcagcc aaccccaccccctga

DBGET integrated database retrieval system