Massilia sp. NR 4-1: ACZ75_26095 Help Entry ACZ75_26095       CDS       T04026                                  Name (GenBank) hypothetical protein   KO K02686   primosomal replication protein N Organism mnr  Massilia sp. NR 4-1 Pathway mnr03440   Homologous recombination Brite KEGG Orthology (KO) [BR:mnr00001]  09120 Genetic Information Processing   09124 Replication and repair    03440 Homologous recombination     ACZ75_26095  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:mnr03400]     ACZ75_26095 DNA repair and recombination proteins [BR:mnr03400]  Prokaryotic type   DSBR (double strand breaks repair)    HR (homologous recombination)     RecBC pathway proteins      ACZ75_26095 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SSB_1 ThrE Motif Other DBs NCBI-ProteinID:  AKU24417 UniProt:  A0A0K1K4S8 LinkDB All DBs Position 6181519..6181809 Genome browser AA seq 96 aa AA seqDB search MNQTQFVALIAEREMLRYTPAGLPIVNAVLQHRSQQMEAGIARLTEFEIAAVAAGDISNR FSQAALGGMYEFRGFLAKKSRNSKSLVFHIIDFRAV NT seq 291 nt NT seq  +upstreamnt  +downstreamnt ctgaaccagacacagtttgtcgccctcatcgccgaacgggaaatgctgcggtataccccg gccggcctgccgatcgtgaatgctgttttgcagcaccgttcgcagcagatggaggccggc atcgcccgcctgaccgagtttgaaatcgccgcggtagccgctggcgacatttcgaaccgc ttcagccaggccgccctcgggggcatgtatgagttcaggggatttctggccaagaaaagc cgcaatagcaaaagcctggtgtttcacatcattgattttcgtgctgtttaa

DBGET integrated database retrieval system