Massilia sp. NR 4-1: ACZ75_26355 Help Entry ACZ75_26355       CDS       T04026                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mnr  Massilia sp. NR 4-1 Pathway mnr01100   Metabolic pathways mnr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mnr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ACZ75_26355    00074 Mycolic acid biosynthesis     ACZ75_26355   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ACZ75_26355 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DNA_ligase_A_N HalOD1 Motif Other DBs NCBI-ProteinID:  AKU25169 UniProt:  A0A0K1K752 LinkDB All DBs Position 6239984..6240241 Genome browser AA seq 85 aa AA seqDB search MSRDEMQQWVVKLLAEMFELDAAELKPESNLYADLDIDSIDAVDLAVQLKQLTGKRLQPE VFKTIRTINDVVDALSGLAVAEQTA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgagccgcgacgagatgcagcaatgggtcgtcaagctgttggctgaaatgtttgaactg gatgcggcggaactgaagccggaatcgaatctgtatgcggacctggacatcgacagcatc gacgccgtcgacctggccgtgcagctgaaacagctgaccggcaagcgcctgcagccggaa gtgttcaagaccatccgcaccatcaacgacgtggtggatgcgctgagcggcctggccgtg gccgaacagacggcctga

DBGET integrated database retrieval system