Moraxella nasovis: LU293_06260 Help Entry LU293_06260       CDS       T08442                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mns  Moraxella nasovis Pathway mns01100   Metabolic pathways mns01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mns00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LU293_06260 (acpP)    00074 Mycolic acid biosynthesis     LU293_06260 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LU293_06260 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  UNU72718 LinkDB All DBs Position 1273518..1273754 Genome browser AA seq 78 aa AA seqDB search MSDIEAKVKGAVAEQLGLNADEIQNEASFMDDLGADSLDLVELVMAFESSFGITIPDEDS AELTTVQKAIDYVTAKVA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatattgaagcaaaagttaaaggtgcggttgctgagcaacttggtttaaatgct gatgaaatccaaaatgaagcatcattcatggacgacctaggtgcagactcactagactta gttgagcttgttatggcatttgaatctagctttggcatcaccatcccagacgaagattca gctgagctgactactgtccaaaaagccatcgattatgtaactgcaaaagttgcttaa

DBGET integrated database retrieval system