Morus notabilis: 112092068 Help Entry 112092068         CDS       T07292                                  Name (RefSeq) mitochondrial Rho GTPase 1-like   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism mnt  Morus notabilis Pathway mnt04145   Phagosome mnt04148   Efferocytosis mnt04620   Toll-like receptor signaling pathway mnt05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:mnt00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     112092068    04148 Efferocytosis     112092068  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     112092068  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     112092068  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mnt04131]     112092068   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mnt04147]     112092068    04031 GTP-binding proteins [BR:mnt04031]     112092068 Membrane trafficking [BR:mnt04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     112092068  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     112092068   Macropinocytosis    Ras GTPases     112092068  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     112092068 Exosome [BR:mnt04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112092068   Exosomal proteins of other body fluids (saliva and urine)    112092068   Exosomal proteins of colorectal cancer cells    112092068   Exosomal proteins of bladder cancer cells    112092068 GTP-binding proteins [BR:mnt04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     112092068 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Motif Other DBs NCBI-GeneID:  112092068 NCBI-ProteinID:  XP_024023020 LinkDB All DBs Position Unknown AA seq 125 aa AA seqDB search PEDNGRVAEELRRADAVVLTYACDQPQTLDRLSTFWLPTLRQLEVRVPVIVVGCKLDLRD ENQQVSLEQVMSPIMQQFREIETCIECSALRHIQIPEVFYYAQKAVLHPTGPLFDQESQT LKPRC NT seq 376 nt NT seq  +upstreamnt  +downstreamnt tcctgaagataatggtagagttgctgaagaattgaggcgcgctgatgcagttgttcttac ttatgcatgtgatcaaccccagacgcttgatcgattgagtaccttctggcttcctacgct tcgccaacttgaggtgagggttccagtcatagttgtaggttgtaaactagatttgagaga tgagaaccagcaggttagcctggagcaagtgatgtcaccaataatgcaacagtttcggga gattgaaacttgcattgaatgttcagcattgagacatatacagattccagaggtttttta ctatgcacaaaaagctgtgctccatccaacaggcccactgtttgatcaggaatcacaaac actgaagcctcgatgc

DBGET integrated database retrieval system