Morus notabilis: 21391745 Help Entry 21391745          CDS       T07292                                  Name (RefSeq) SKP1-like protein 1   KO K03094   S-phase kinase-associated protein 1 Organism mnt  Morus notabilis Pathway mnt03083   Polycomb repressive complex mnt04120   Ubiquitin mediated proteolysis mnt04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:mnt00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     21391745    04120 Ubiquitin mediated proteolysis     21391745   09126 Chromosome    03083 Polycomb repressive complex     21391745  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mnt04131]     21391745    04121 Ubiquitin system [BR:mnt04121]     21391745    03036 Chromosome and associated proteins [BR:mnt03036]     21391745 Membrane trafficking [BR:mnt04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     21391745 Ubiquitin system [BR:mnt04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      21391745    Cul7 complex      21391745 Chromosome and associated proteins [BR:mnt03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      21391745   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      21391745 SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ HN Motif Other DBs NCBI-GeneID:  21391745 NCBI-ProteinID:  XP_010107659 UniProt:  W9RXC8 LinkDB All DBs Position Unknown AA seq 161 aa AA seqDB search MSSSSEEKKNTMIKLRSSDDQIFEVADEVAKMSQTLKNLVDDGCSIDLPIPVTNVSGNIL SKVMEYCQKHVDSAAASADSTEWLKSWDAEFVSVDQATLFDLILAANYLNIQSLLDLTCQ TVADMIKGKTPEEIRKTFNIKNDFTREEEEEVRKENQWAFE NT seq 486 nt NT seq  +upstreamnt  +downstreamnt atgtcgtcgtcttcggaggagaagaagaatactatgataaagctaaggagctcggacgac caaatcttcgaagtcgccgacgaggtggcgaagatgtcgcagacgctcaagaacttggtg gacgacggctgcagcatcgacctccccatcccggtgaccaatgtctctggaaacatcctc tccaaggtcatggaatactgccagaagcacgtcgattccgccgccgcctccgccgatagt actgaatggctcaagtcttgggacgccgaattcgtcagtgtcgaccaggccactctcttc gacctcatcttggcagcgaactatctgaacatccaaagcctactggatctgacttgccag actgtggcagacatgataaaggggaagactcctgaggagattcgcaagactttcaacatc aagaatgacttcacccgggaggaagaagaggaggttcgtaaggagaatcaatgggccttt gagtag

DBGET integrated database retrieval system