Morus notabilis: 21405183 Help Entry 21405183          CDS       T07292                                  Name (RefSeq) sm-like protein LSM8   KO K12627   U6 snRNA-associated Sm-like protein LSm8 Organism mnt  Morus notabilis Pathway mnt03018   RNA degradation mnt03040   Spliceosome Brite KEGG Orthology (KO) [BR:mnt00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     21405183   09123 Folding, sorting and degradation    03018 RNA degradation     21405183  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:mnt03019]     21405183    03041 Spliceosome [BR:mnt03041]     21405183 Messenger RNA biogenesis [BR:mnt03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      21405183   mRNA degradation factors    5'-3' decay     Lsm complex      21405183 Spliceosome [BR:mnt03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     21405183 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  LSM DUF150_C Motif Other DBs NCBI-GeneID:  21405183 NCBI-ProteinID:  XP_010089849 UniProt:  W9QJF6 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search MSGGPGLESLVDHTISVITNDGRNIVGILKGFDQATNIILDESHERVFSTKEGVQQLVLG LYIIRGDNISIVGELDEDLDSSLDWSKMRAHPLKPVIH NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgtctggtggtccgggacttgagtctcttgtagatcatacaatatcagtcataacaaat gatgggcgcaatattgtgggaatcttgaaagggtttgaccaggccacaaatatcattctt gacgaatctcacgaacgtgttttctccacaaaggaaggtgttcagcaacttgtgttgggg ttgtatataatcagaggcgacaacataagcattgttggggaactagatgaagatcttgat tccagtctcgactggtcgaaaatgagagctcatcccctaaaaccagtcatccattga

DBGET integrated database retrieval system