Morus notabilis: 21409285 Help Entry 21409285          CDS       T07292                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism mnt  Morus notabilis Pathway mnt03083   Polycomb repressive complex mnt04120   Ubiquitin mediated proteolysis mnt04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:mnt00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     21409285    04120 Ubiquitin mediated proteolysis     21409285   09126 Chromosome    03083 Polycomb repressive complex     21409285  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mnt04131]     21409285    04121 Ubiquitin system [BR:mnt04121]     21409285    03036 Chromosome and associated proteins [BR:mnt03036]     21409285 Membrane trafficking [BR:mnt04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     21409285 Ubiquitin system [BR:mnt04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      21409285    Cul7 complex      21409285 Chromosome and associated proteins [BR:mnt03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      21409285   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      21409285 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ DUF5470 FAM117 Motif Other DBs NCBI-GeneID:  21409285 NCBI-ProteinID:  XP_010113308 UniProt:  W9T0P4 LinkDB All DBs Position Unknown AA seq 163 aa AA seqDB search MSTSSSKKIVLRSSDGESFEVEEAVALQSQTIKHMVEDVSDDSAIPLPNVTSRILSKVIE YCNRHSDASSSASASASAGASDDNDLKSWDAEFVKVDQATLFDLILAANYLNIKNLLDLT CQTVADMIKGKTPEEIRSTFNIKNDFTPEEEEEVRRENQWAFE NT seq 492 nt NT seq  +upstreamnt  +downstreamnt atgtcgacgtcgtcgtcaaagaagatcgtgcttcggagttcggacggcgagtctttcgag gtggaggaggcggtggcgctgcagtcgcagacgataaagcacatggtggaggacgtctcc gacgacagcgccatccccttgcccaacgtcaccagcagaatcctctccaaggttatcgag tactgcaaccgccactccgatgcctcctcctccgcctccgcctccgcctccgccggcgcc tctgacgacaatgatctcaagtcctgggacgccgagttcgtcaaggttgaccaggccact ctcttcgacctcattctggctgcaaactacttgaacatcaagaacctgctggacttgaca tgtcagaccgtggcagacatgatcaagggaaagaccccagaagagatcaggagtaccttc aatatcaagaatgattttactcccgaggaagaggaggaggttcggcgtgaaaaccagtgg gcttttgagtga

DBGET integrated database retrieval system