Morus notabilis: 24286642 Help Entry 24286642          CDS       T07292                                  Symbol psbF, AA844_gp048 Name (RefSeq) photosystem II protein VI   KO K02708   photosystem II cytochrome b559 subunit beta Organism mnt  Morus notabilis Pathway mnt00195   Photosynthesis mnt01100   Metabolic pathways Module mnt_M00161   Photosystem II mnt_M00611   Oxygenic photosynthesis in plants and cyanobacteria Brite KEGG Orthology (KO) [BR:mnt00001]  09100 Metabolism   09102 Energy metabolism    00195 Photosynthesis     24286642 (psbF)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:mnt00194]     24286642 (psbF) Photosynthesis proteins [BR:mnt00194]  Photosystem and electron transport system   Photosystem II (P680 chlorophyll a) [OT]    Main subunits     24286642 (psbF) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_B559 Motif Other DBs NCBI-GeneID:  24286642 NCBI-ProteinID:  YP_009139695 UniProt:  A0A0F6ZEE1 LinkDB All DBs AA seq 39 aa AA seqDB search MTIDRTYPIFTVRWLAVHGLAVPTVSFLGSISAMQFIQR NT seq 120 nt NT seq  +upstreamnt  +downstreamnt atgactatagatagaacctatccaatttttacagtgcgatggttagctgttcacggacta gctgtacctaccgtttcttttttggggtcaatatcagcaatgcagttcatccaacgataa

DBGET integrated database retrieval system