Microvirga ossetica: BB934_22680 Help Entry BB934_22680       CDS       T05139                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism moc  Microvirga ossetica Pathway moc01100   Metabolic pathways moc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:moc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BB934_22680    00074 Mycolic acid biosynthesis     BB934_22680   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BB934_22680 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C DUF1493 Motif Other DBs NCBI-ProteinID:  ANY80689 UniProt:  A0A1B2EL63 LinkDB All DBs Position 4788904..4789140 Genome browser AA seq 78 aa AA seqDB search MSDVADRVKKIVVEHLGVEADKVTDNANFIDDLGADSLDTVELVMAFEEEFNVEIPDDAA ETIVTVGDAIRFLEKNAA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtgacgtcgctgatcgcgtgaagaagattgttgtcgagcacctcggcgtcgaagcc gacaaggtgaccgacaatgccaacttcatcgacgacctgggcgccgacagcctggatacg gtcgagctggtaatggcgttcgaggaggagttcaacgtcgagatcccggacgacgcggct gagaccatcgtcacggtcggcgacgccatccgcttcctcgagaagaacgcagcctaa

DBGET integrated database retrieval system