Microvirga ossetica: BB934_44530 Help Entry BB934_44530       CDS       T05139                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism moc  Microvirga ossetica Brite KEGG Orthology (KO) [BR:moc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:moc03032]     BB934_44530    03036 Chromosome and associated proteins [BR:moc03036]     BB934_44530    03400 DNA repair and recombination proteins [BR:moc03400]     BB934_44530 DNA replication proteins [BR:moc03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     BB934_44530 Chromosome and associated proteins [BR:moc03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     BB934_44530 DNA repair and recombination proteins [BR:moc03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       BB934_44530 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 NA37 Motif Other DBs NCBI-ProteinID:  ANY85380 UniProt:  A0A1B2EZG5 LinkDB All DBs Position unnamed4:485156..485428 Genome browser AA seq 90 aa AA seqDB search MLTLRHIAEQLSQAHELPKRQANEVLTQVIEMIAKSLKKGDKIRLSGLGILQVRKRAARM GRNPQTGEPIKIKASKKIAFRPAKELKEAV NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atcctgaccctgcgccatattgccgagcagctgtcgcaagcgcatgagctgcccaagcgc caggccaatgaggtgctgacgcaggtgatcgagatgatcgccaagagcctgaagaagggc gacaagatccgcctgagcggtctcggaatcctgcaggtgcgcaagcgcgccgcccgcatg ggccgcaatccgcagaccggcgagccgatcaagatcaaagcgtccaagaagatcgcattt cggcccgccaaggagctcaaggaggcggtctga

DBGET integrated database retrieval system