Malania oleifera: 131144071 Help Entry 131144071         CDS       T09312                                  Name (RefSeq) calmodulin   KO K02183   calmodulin Organism mof  Malania oleifera Pathway mof04016   MAPK signaling pathway - plant mof04070   Phosphatidylinositol signaling system mof04075   Plant hormone signal transduction mof04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:mof00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     131144071    04070 Phosphatidylinositol signaling system     131144071    04075 Plant hormone signal transduction     131144071  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     131144071  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mof01009]     131144071   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mof04131]     131144071    03036 Chromosome and associated proteins [BR:mof03036]     131144071   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mof04147]     131144071 Protein phosphatases and associated proteins [BR:mof01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      131144071 Membrane trafficking [BR:mof04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     131144071 Chromosome and associated proteins [BR:mof03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      131144071 Exosome [BR:mof04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    131144071 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH SPARC_Ca_bdg EF_EFCAB10_C EF-hand_11 UPF0154 DUF5580_M Dockerin_1 EFhand_Ca_insen RNA_pol_Rpb4 Caleosin SPEF2_C FCaBP_EF-hand MotA_activ SurA_N_3 PA_Ig-like Fe_hyd_lg_C PhageMin_Tail MecA_N DUF6279 Motif Other DBs NCBI-GeneID:  131144071 NCBI-ProteinID:  XP_057948426 LinkDB All DBs Position 12:17070091..17074416 Genome browser AA seq 149 aa AA seqDB search MAEQLTEEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYEEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcggagcagctcaccgaagagcagatcagtgagttcaaggaggctttcagcttgttc gacaaggacggagatggttgcatcaccacaaaggagcttgggacagtgatgaggtcgctg gggcaaaacccgactgaggcggagctccaggacatgattaacgaagtggatgctgatggt aatgggaccattgattttcctgagtttctaaacctcatggctaggaagatgaaggatact gattctgaggaggagctgaaggaggcattccgagtttttgacaaggatcagaatgggttc atctcggctgctgagctgcgtcatgtaatgaccaacctcggggaaaagcttaccgacgaa gaagtggatgaaatgattcgggaggccgacgttgatggagatggacagataaattacgaa gagtttgtgaaggtcatgatggccaagtga

DBGET integrated database retrieval system