Malania oleifera: 131145817 Help Entry 131145817         CDS       T09312                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism mof  Malania oleifera Pathway mof03083   Polycomb repressive complex mof04120   Ubiquitin mediated proteolysis mof04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:mof00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     131145817    04120 Ubiquitin mediated proteolysis     131145817   09126 Chromosome    03083 Polycomb repressive complex     131145817  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mof04131]     131145817    04121 Ubiquitin system [BR:mof04121]     131145817    03036 Chromosome and associated proteins [BR:mof03036]     131145817 Membrane trafficking [BR:mof04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     131145817 Ubiquitin system [BR:mof04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      131145817    Cul7 complex      131145817 Chromosome and associated proteins [BR:mof03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      131145817   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      131145817 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Med7 Motif Other DBs NCBI-GeneID:  131145817 NCBI-ProteinID:  XP_057950985 LinkDB All DBs Position 13:complement(41498552..41498857) Genome browser AA seq 101 aa AA seqDB search MSTRKITLRSSDSEIFEIDDIVALESQTIKHMLEDDCANNGIPLPTVTSKILAKVIEYCK KHIESPKNDDQNANDKLKSLDTNFVNVDQTILFDLILAANY NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgtcaacaaggaagatcacgctgaggagctccgacagcgagatctttgagatcgacgat attgtggcactcgagtctcagacgatcaagcacatgctcgaggacgattgtgccaacaat ggtattcccttgcccactgtcacaagcaagatcttggccaaggtaatcgaatattgcaag aaacacatcgagagtccgaaaaatgatgatcaaaatgccaatgacaaactcaagtccttg gacaccaatttcgtcaatgttgaccagacgattctctttgacctcattttggctgcaaac tattag

DBGET integrated database retrieval system