Malania oleifera: 131146294 Help Entry 131146294         CDS       T09312                                  Name (RefSeq) SKP1-like protein 1   KO K03094   S-phase kinase-associated protein 1 Organism mof  Malania oleifera Pathway mof03083   Polycomb repressive complex mof04120   Ubiquitin mediated proteolysis mof04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:mof00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     131146294    04120 Ubiquitin mediated proteolysis     131146294   09126 Chromosome    03083 Polycomb repressive complex     131146294  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mof04131]     131146294    04121 Ubiquitin system [BR:mof04121]     131146294    03036 Chromosome and associated proteins [BR:mof03036]     131146294 Membrane trafficking [BR:mof04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     131146294 Ubiquitin system [BR:mof04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      131146294    Cul7 complex      131146294 Chromosome and associated proteins [BR:mof03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      131146294   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      131146294 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ DarP Motif Other DBs NCBI-GeneID:  131146294 NCBI-ProteinID:  XP_057951769 LinkDB All DBs Position 13:complement(78614964..78616036) Genome browser AA seq 151 aa AA seqDB search MTLVLKTSDGQIFQVEEAVALQAGLIKLLVEDGCSADVIPLPNVTGAILSKVLEFCKKHA HASADAAAADAENLNSWDADFVDVDLDVLYDLIMAANYLDIKELVDLTCETVAEMIKGKQ PEEIRKIFKIKNDFSPEEEGEIRRENQWAFD NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgacgctcgtcttgaagacctccgacggccaaatcttccaggtggaagaggcggtggcg ttgcaggccggattgatcaagctcttggtcgaagacggatgctccgccgacgttatcccc ctccccaacgtcaccggcgccatcctctccaaggtcctcgagttctgcaagaagcacgcc catgcttccgccgatgccgccgccgccgacgccgagaatctgaattcctgggacgccgac ttcgtcgatgtcgatttggacgtcctctacgatctcatcatggctgcgaactatttggac ataaaggagctggtggacctgacatgcgagacggtggcggagatgataaaggggaagcag ccggaggagataaggaagatcttcaagatcaagaacgacttctcgccggaggaagagggg gagattcgccgggagaaccagtgggctttcgactga

DBGET integrated database retrieval system