Malania oleifera: 131149375 Help Entry 131149375         CDS       T09312                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism mof  Malania oleifera Brite KEGG Orthology (KO) [BR:mof00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:mof03041]     131149375   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mof04052]     131149375 Spliceosome [BR:mof03041]  Complex B   Other components    Complex B specific factors     131149375 Cytokines and neuropeptides [BR:mof04052]  Neuropeptides   Unclassified    131149375 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Rad60-SLD OTU1_UBXL Ubiquitin_4 Crinkler Motif Other DBs NCBI-GeneID:  131149375 NCBI-ProteinID:  XP_057955758 LinkDB All DBs Position 2:27064537..27067423 Genome browser AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRADKIRIQKWYTVYKDHITLKDY EVHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgattgaagtggtattgaacgatcggctggggaagaaggtgagggtgaagtgcaacgaa gacgacaccatcggcgatctgaagaagctggtggccgctcaaacgggaaccagagctgac aagatcaggattcagaagtggtatactgtctacaaggatcacatcacccttaaagactac gaggtccacgatggcatgggcctcgagctctactacaactaa

DBGET integrated database retrieval system