Malania oleifera: 131151225 Help Entry 131151225         CDS       T09312                                  Name (RefSeq) SKP1-like protein 1   KO K03094   S-phase kinase-associated protein 1 Organism mof  Malania oleifera Pathway mof03083   Polycomb repressive complex mof04120   Ubiquitin mediated proteolysis mof04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:mof00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     131151225    04120 Ubiquitin mediated proteolysis     131151225   09126 Chromosome    03083 Polycomb repressive complex     131151225  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mof04131]     131151225    04121 Ubiquitin system [BR:mof04121]     131151225    03036 Chromosome and associated proteins [BR:mof03036]     131151225 Membrane trafficking [BR:mof04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     131151225 Ubiquitin system [BR:mof04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      131151225    Cul7 complex      131151225 Chromosome and associated proteins [BR:mof03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      131151225   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      131151225 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ PBP_N Fry_C Motif Other DBs NCBI-GeneID:  131151225 NCBI-ProteinID:  XP_057958462 LinkDB All DBs Position 3:complement(27526380..27531924) Genome browser AA seq 98 aa AA seqDB search MTITLKTSDGEIFEMEEAAAMQAGTIELLIEDDCAGDVIPSTTSPPPPSPGFSSTPRVSQ QHAAADDNDDLKSWVAGFLKVDLDALIDLLMFSIVSLL NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgacgatcaccctaaagacctccgacggcgaaatcttcgagatggaggaggctgcggcg atgcaggcgggcacgatcgagctcctgatcgaggacgactgcgccggtgacgtcatccca tccacaacgtcaccgccgcccccctctccagggttctcgagtactccaagagtttcacaa cagcacgccgccgccgacgacaacgacgatctgaagtcctgggtcgccggcttcctcaag gtcgatctagacgccctgatcgatctgctcatgtttagtatcgtatctcttctctag

DBGET integrated database retrieval system