Malania oleifera: 131156070 Help Entry 131156070         CDS       T09312                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism mof  Malania oleifera Pathway mof03083   Polycomb repressive complex mof04120   Ubiquitin mediated proteolysis mof04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:mof00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     131156070    04120 Ubiquitin mediated proteolysis     131156070   09126 Chromosome    03083 Polycomb repressive complex     131156070  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mof04131]     131156070    04121 Ubiquitin system [BR:mof04121]     131156070    03036 Chromosome and associated proteins [BR:mof03036]     131156070 Membrane trafficking [BR:mof04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     131156070 Ubiquitin system [BR:mof04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      131156070    Cul7 complex      131156070 Chromosome and associated proteins [BR:mof03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      131156070   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      131156070 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 Ig_PDGFR_d4 Motif Other DBs NCBI-GeneID:  131156070 NCBI-ProteinID:  XP_057965502 LinkDB All DBs Position 5:101342019..101342324 Genome browser AA seq 101 aa AA seqDB search MLEDNCANNGIPLPNVTSKILAKVIEYCKKRVEATKTDDQSTNEELKSWDTDFVKVYQTT IFNLILAANYLNIKSLLDLTCQTVADKDIGIDEKMLTQDLS NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgctcgaggacaactgtgccaacaacggtattcccctgcctaatgtcaccagcaagatt ttggccaaggtgatcgaatattgcaagaaacgcgtcgaggctacgaaaactgacgatcaa agcaccaacgaagagctcaaatcctgggacaccgattttgtcaaggtttaccaaacgact atcttcaatctcattctagctgcgaactatttgaacatcaaaagcttgctagatcttaca tgccaaacggttgccgacaaagatattgggattgatgagaaaatgttgacgcaggatcta tcttag

DBGET integrated database retrieval system