Malania oleifera: 131156649 Help Entry 131156649         CDS       T09312                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism mof  Malania oleifera Pathway mof04145   Phagosome mof04148   Efferocytosis mof04517   IgSF CAM signaling mof04518   Integrin signaling mof04620   Toll-like receptor signaling pathway mof05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:mof00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     131156649    04518 Integrin signaling     131156649  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     131156649    04148 Efferocytosis     131156649  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     131156649  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     131156649  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mof04131]     131156649   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mof04147]     131156649    04031 GTP-binding proteins [BR:mof04031]     131156649 Membrane trafficking [BR:mof04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     131156649  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     131156649   Macropinocytosis    Ras GTPases     131156649  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     131156649 Exosome [BR:mof04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    131156649   Exosomal proteins of other body fluids (saliva and urine)    131156649   Exosomal proteins of colorectal cancer cells    131156649   Exosomal proteins of bladder cancer cells    131156649 GTP-binding proteins [BR:mof04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     131156649 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  131156649 NCBI-ProteinID:  XP_057966482 LinkDB All DBs Position 5:complement(3917637..3923584) Genome browser AA seq 198 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGIPIILVGTKL DLRDDKQFFMDHPGAVPITTVQGEELRKAIGAPAYIECSSKTQQNVKAVFDAAIKVVLQP PKQKKRKKKKGQKACSIL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgagcgcgtccaggttcatcaagtgtgtcaccgtcggcgatggcgctgttggtaaaact tgcatgcttatctcctacaccagcaacactttccccacggattacgtgccaacagtgttt gacaattttagcgcaaatgtggttgtggatgggagcaccgttaatctgggtttgtgggat actgcaggccaggaggattacaacagattgagacctttgagctatcgtggggcggatgtt tttttgctggcattttccctcatcagcaaagccagttatgaaaatgttgccaagaaatgg attcctgaattaaggcattatgctcctggcatcccaatcattcttgttgggacgaaactt gatcttcgggacgataagcaattttttatggaccatcctggtgctgtacctattacaacc gtgcagggggaggagctgaggaaggcaattggagctcctgcttacattgaatgcagttca aaaacgcaacagaatgtaaaggctgtatttgatgcggccattaaggtggttctccagcca ccaaagcagaagaagagaaagaagaagaagggacaaaaggcctgctcgatattgtga

DBGET integrated database retrieval system