Malania oleifera: 131159417 Help Entry 131159417         CDS       T09312                                  Name (RefSeq) protein MHF1 homolog   KO K11511   centromere protein S Organism mof  Malania oleifera Pathway mof03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:mof00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     131159417  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mof03036]     131159417    03400 DNA repair and recombination proteins [BR:mof03400]     131159417 Chromosome and associated proteins [BR:mof03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      131159417 DNA repair and recombination proteins [BR:mof03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      131159417 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-S CENP-T_C TFIID-31kDa Bromo_TP NagA_C UCH_UBL1 DUF1175 Motif Other DBs NCBI-GeneID:  131159417 NCBI-ProteinID:  XP_057970283 LinkDB All DBs Position 7:111105731..111111613 Genome browser AA seq 137 aa AA seqDB search MEGGGASDAEREDDDAATELLRDRFRLATISIAEAEAKKNEMEISEQIVACISDLAFKYT EQLGKDLELFAQHAGRKSVNMEDVILSAHRNEHLAASLRSFSNELKAKEPQSERKKRKKA SRMEDRASTSVLHIPEP NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atggaaggaggaggagcaagcgatgcggagagagaggacgacgacgccgcgactgagctt ctgagagatcgattcagactcgccactatctcaattgccgaagctgaagcgaagaaaaat gaaatggaaatatccgaacaaatcgtagcttgcatttccgatttagccttcaaatatact gaacagttagggaaggacctcgagttatttgcacagcatgctggtcgtaaatctgtgaac atggaagatgtcatactttcagcgcacagaaatgaacacctggctgcctcattgaggtcc ttcagcaatgaactgaaggcgaaagaaccccagtcggagaggaagaagcggaagaaagcg tcgagaatggaagatagagctagcaccagtgtgttgcatattcccgagccctga

DBGET integrated database retrieval system