Malania oleifera: 131161342 Help Entry 131161342         CDS       T09312                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism mof  Malania oleifera Pathway mof04145   Phagosome mof04148   Efferocytosis mof04620   Toll-like receptor signaling pathway mof05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:mof00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     131161342    04148 Efferocytosis     131161342  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     131161342  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     131161342  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mof04131]     131161342   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mof04147]     131161342    04031 GTP-binding proteins [BR:mof04031]     131161342 Membrane trafficking [BR:mof04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     131161342  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     131161342   Macropinocytosis    Ras GTPases     131161342  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     131161342 Exosome [BR:mof04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    131161342   Exosomal proteins of other body fluids (saliva and urine)    131161342   Exosomal proteins of colorectal cancer cells    131161342   Exosomal proteins of bladder cancer cells    131161342 GTP-binding proteins [BR:mof04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     131161342 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  131161342 NCBI-ProteinID:  XP_057973029 LinkDB All DBs Position 8:104143581..104148005 Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL DLRDDKQFFIDHPGSVPITTAQGEELRKVIGAPAYIECSSKTQQNVKAVFDAAIKVVLQP PKQKKKKRKAQKACSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagcgcgtctcggttcataaagtgcgtgacggtcggcgatggcgctgttggcaaaacc tgcatgctgatctcctacacaagcaacacattccctacggactatgtgccaaccgttttt gacaatttcagtgcaaatgttgtggttgatgggagcacagtcaacctagggctgtgggat actgctggtcaggaggactataataggttaagacctctcagctatcgaggggcagatgtg tttcttcttgcattttctcttataagcaaggctagttatgaaaatgttgccaagaagtgg attcctgaacttaggcattatgcacctggtgttccaataatccttgttggaacaaagctt gatcttcgggatgataagcagttttttatagaccaccctggttcagtaccgatcactaca gctcagggtgaggaactgagaaaggttattggggcccctgcctacatcgaatgtagttca aaaacacagcagaatgttaaggccgttttcgacgcagccattaaggtggtactccagcca cctaagcaaaagaagaagaagaggaaggcacagaaggcctgctccatattgtga

DBGET integrated database retrieval system