Mesorhizobium onobrychidis: IHQ72_09880 Help Entry IHQ72_09880       CDS       T08462                                  Name (GenBank) sarcosine oxidase subunit delta   KO K00304   sarcosine oxidase, subunit delta [EC:1.5.3.24 1.5.3.1] Organism moh  Mesorhizobium onobrychidis Pathway moh00260   Glycine, serine and threonine metabolism moh01100   Metabolic pathways Module moh_M00975   Betaine degradation, bacteria, betaine => pyruvate Brite KEGG Orthology (KO) [BR:moh00001]  09100 Metabolism   09105 Amino acid metabolism    00260 Glycine, serine and threonine metabolism     IHQ72_09880 Enzymes [BR:moh01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.3  With oxygen as acceptor     1.5.3.1  sarcosine oxidase (formaldehyde-forming)      IHQ72_09880     1.5.3.24  sarcosine oxidase (5,10-methylenetetrahydrofolate-forming)      IHQ72_09880 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SoxD Motif Other DBs NCBI-ProteinID:  UVC17402 LinkDB All DBs Position 2007006..2007302 Genome browser AA seq 98 aa AA seqDB search MLLIRCPYCEEERPELEFRNAGEAHIARSADMAGESDDDFEKFFFIRSNPKGIIYERWRH MHGCARFFNAVRDTVSDRFLMTYKAGEPKPANLPGAAK NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgcttctcatccgctgcccctattgcgaggaagagcgtccggaactcgaattccgcaac gccggcgaggcgcatatcgcgcgttcggcagatatggccggcgagagcgacgatgatttc gaaaagttcttcttcatccgctcgaaccccaaaggcatcatctatgagcgctggcggcat atgcatggctgcgcgcggttcttcaatgccgtgcgcgacaccgtcagcgacaggttcctg atgacctacaaggccggcgaacccaagccggcgaacctgccgggagccgccaaatga

DBGET integrated database retrieval system