Methanothermococcus okinawensis: Metok_1398 Help Entry Metok_1398        CDS       T01534                                  Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism mok  Methanothermococcus okinawensis Pathway mok03010   Ribosome Brite KEGG Orthology (KO) [BR:mok00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Metok_1398   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Metok_1398  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mok03011]     Metok_1398    04121 Ubiquitin system [BR:mok04121]     Metok_1398 Ribosome [BR:mok03011]  Ribosomal proteins   Eukaryotes    Large subunit     Metok_1398   Archaea     Metok_1398 Ubiquitin system [BR:mok04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Metok_1398 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e Zn_Ribbon_1 DZR DZR_2 Zn_ribbon_RPAB4 Motif Other DBs NCBI-ProteinID:  AEH07363 UniProt:  F8AK04 LinkDB All DBs Position complement(1443160..1443303) Genome browser AA seq 47 aa AA seqDB search MAFEEAMNRIFKKKICMRCNARNPWKATKCRKCGYSKLRPKAKEARG NT seq 144 nt NT seq  +upstreamnt  +downstreamnt atggcatttgaagaagcaatgaatagaatttttaagaaaaaaatttgcatgagatgcaat gcaagaaacccatggaaagctacaaaatgcagaaaatgtggatactcaaaattgagacca aaagctaaggaagcaagaggataa

DBGET integrated database retrieval system