Methanobrevibacter olleyae: YLM1_0977 Help Entry YLM1_0977         CDS       T04385                                  Name (GenBank) ribosomal protein S27ae Rps27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mol  Methanobrevibacter olleyae Pathway mol03010   Ribosome Brite KEGG Orthology (KO) [BR:mol00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     YLM1_0977   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     YLM1_0977  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mol03011]     YLM1_0977    04121 Ubiquitin system [BR:mol04121]     YLM1_0977   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mol04147]     YLM1_0977 Ribosome [BR:mol03011]  Ribosomal proteins   Eukaryotes    Small subunit     YLM1_0977   Archaea     YLM1_0977 Ubiquitin system [BR:mol04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    YLM1_0977 Exosome [BR:mol04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    YLM1_0977   Exosomal proteins of colorectal cancer cells    YLM1_0977 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Ribosomal_L37e Zn_ribbon_IS1595 Zn_ribbon_NUD MqsA_antitoxin Zn_ribbon_Nudix Alsin_RLD Zn_ribbon_TiaS Motif Other DBs NCBI-ProteinID:  AMK15534 UniProt:  A0A126R0D9 LinkDB All DBs Position complement(1174135..1174293) Genome browser AA seq 52 aa AA seqDB search MTDKKGLYSVDGDKIVRKNPFCPRCSEGVFMADHGDRYACGKCGYTEMKTKE NT seq 159 nt NT seq  +upstreamnt  +downstreamnt atgactgataaaaaaggcttatatagtgtagatggagacaaaatcgtaagaaaaaatcct ttctgtcctcgttgttctgaaggtgtatttatggctgaccatggtgatagatacgcttgt ggtaaatgtggatacactgaaatgaaaactaaagaataa

DBGET integrated database retrieval system