Microbacterium oleivorans: BWL13_02088 Help Entry BWL13_02088       CDS       T05832                                  Symbol atpE Name (GenBank) ATP synthase subunit c   KO K02110   F-type H+-transporting ATPase subunit c Organism moo  Microbacterium oleivorans Pathway moo00190   Oxidative phosphorylation moo01100   Metabolic pathways Module moo_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:moo00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     BWL13_02088 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:moo00194]     BWL13_02088 (atpE) Photosynthesis proteins [BR:moo00194]  Photosystem and electron transport system   F-type ATPase [OT]    BWL13_02088 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C DUF2938 Motif Other DBs NCBI-ProteinID:  AZS44499 UniProt:  A0A031FP24 LinkDB All DBs Position complement(2112884..2113129) Genome browser AA seq 81 aa AA seqDB search MDATTVLAALHGNIATVGYGLAAIGPAIGVGIVVGKTIEGVARQPELAGRLQVLMFIGIA FTEALAFIGIATYFIFTNVTP NT seq 246 nt NT seq  +upstreamnt  +downstreamnt gtggacgcaactacggttctcgccgccctgcacggcaacatcgccaccgtcggctacggt cttgccgccatcggtcccgccatcggcgtgggcatcgtcgtcggaaagacgatcgagggc gtcgcccgtcagcccgagctggccggtcgtcttcaggtcctgatgttcatcggtatcgcc ttcaccgaggcgctcgcgttcatcggcatcgcgacgtacttcatcttcacgaacgtcact ccgtaa

DBGET integrated database retrieval system