Mesorhizobium opportunistum: Mesop_5243 Help Entry Mesop_5243        CDS       T01542                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mop  Mesorhizobium opportunistum Pathway mop01100   Metabolic pathways mop01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mop00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Mesop_5243    00074 Mycolic acid biosynthesis     Mesop_5243   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Mesop_5243 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Motif Other DBs NCBI-ProteinID:  AEH89659 UniProt:  F7Y634 LinkDB All DBs Position complement(5349178..5349414) Genome browser AA seq 78 aa AA seqDB search MSDTAERVKKIVIEHLGVDADKVTEQASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA ETILTVGDAVKYIDKASA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtgacaccgcagagcgcgtcaagaagatcgtcatcgaacaccttggcgtcgatgcc gacaaagtgacggagcaggcgagcttcatcgacgatctgggcgccgacagcctcgacacg gtcgaactcgtcatggcgttcgaagaagaattcggcgtcgagattcccgacgacgcggcc gagaccatcctgaccgtcggggatgcggtgaagtacatcgacaaggcttcggcctga

DBGET integrated database retrieval system