Moritella sp. 36: HWV03_11655 Help Entry HWV03_11655       CDS       T08847                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism moq  Moritella sp. 36 Pathway moq00998   Biosynthesis of various antibiotics moq01100   Metabolic pathways moq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:moq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HWV03_11655 (acpP)    00074 Mycolic acid biosynthesis     HWV03_11655 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HWV03_11655 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB Motif Other DBs NCBI-ProteinID:  QUM89406 LinkDB All DBs Position complement(2607595..2607831) Genome browser AA seq 78 aa AA seqDB search MSNFEERVKKIIIEQLGVKEEEVKNEASFVDDLGADSLDTVELVMALEEEFDTDIPDDEA EKITTVQAAIDFVVSSAE NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtaacttcgaagaacgcgtaaaaaaaatcattattgaacaacttggtgttaaagaa gaagaagtgaaaaacgaagcttcttttgttgatgacctaggtgcagattctctagataca gttgaactagttatggctctagaagaagaattcgatactgatatcccagacgatgaagca gagaaaatcactactgttcaagctgcaatcgacttcgttgtttctagcgctgaataa

DBGET integrated database retrieval system