Moritella sp. 36: HWV03_14875 Help Entry HWV03_14875       CDS       T08847                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism moq  Moritella sp. 36 Pathway moq00998   Biosynthesis of various antibiotics moq01100   Metabolic pathways moq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:moq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HWV03_14875    00074 Mycolic acid biosynthesis     HWV03_14875   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HWV03_14875 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF2748 Motif Other DBs NCBI-ProteinID:  QUM89996 LinkDB All DBs Position complement(3375341..3375592) Genome browser AA seq 83 aa AA seqDB search MQSREHIYQTLADILVEEFEIDADDINLSAHLYTDLDLDSIDAIDLVIKLREITNEKIEP EVFKLVRTVEDVVNEIEKLTLAK NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgcaatctagagaacacatctaccaaacattagccgacatcttagttgaagaatttgaa atcgatgcagacgatatcaacctcagtgcccatctatatactgacttagatttagacagt attgatgccattgacttagtgattaaattacgcgagattactaacgaaaaaattgaacct gaagtgttcaaattagtacgtacagtagaagatgttgtaaacgaaatcgaaaaactaacg ttggcgaaataa

DBGET integrated database retrieval system